BastionHub | Browse Page

Browse

All five types of bacterial secreted substrate proteins are listed below. Users can directly click the BastionHub ID for quick access to the corresponding entry.

Type I secretion system (T1SS)

Type II secretion system (T2SS)

Type III secretion system (T3SS)

Type IV secretion system (T4SS)

Type VI secretion system (T6SS)

T1SS substrate

Top

BastionHub ID	Gene Name	Brief Description	Species	UniProt ID	NCBI ID	PubMed ID
SS02226	mcbA	McbA (Reference); Bacteriocin microcin B17 (UniProt, NCBI)	Escherichia coli	P05834	EAA5695944.1	8302219
SS02227		Serralysin (UniProt)	Serratia marcescens	P07268	WP_033644999.1	3253732
SS02228	hlyA	HlyA (Reference); hemolysin A (NCBI)	Escherichia coli	P08715	AAA98233.1	23541474
SS02229	lktA	LktA (Reference); leukotoxin A (NCBI)	Mannheimia haemolytica	P0C081	AFI60251.1	20528947
SS02230		Hemolysin, heat labile (UniProt, NCBI)	Grimontia hollisae	P14711	P14711.1	3253732
SS02231	cya	CyaA (Reference); bifunctional adenylate cyclase toxin/hemolysin CyaA (NCBI)	Bordetella pertussis	J7QLC0	WP_010929995.1	20528947
SS02232	apxIIA	ApxIIA (Reference); RTX-II toxin determinant A (UniProt)	Actinobacillus pleuropneumoniae	P15377	BAV25207.1	20528947
SS02233	nodO	NodO (Reference); Nodulation protein O (UniProt)	Rhizobium leguminosarum	P15728	AAA26341.1	20528947
SS02234	prtB	PrtB (Reference); Serralysin B (UniProt)	Dickeya chrysanthemi	P16316	AAA24861.1	20528947
SS02235	prtC	PrtC (Reference); Serralysin C (UniProt)	Dickeya chrysanthemi	P16317	1K7G_A	20528947
SS02236	cvaC	Colicin-V (UniProt)	Escherichia coli	P22522	YP_002527505.1
SS02237		Lipase (UniProt)	Pseudomonas fluorescens	P26504	BAA02012.1	3253732
SS02238	sapA	S-layer protein (UniProt)	Campylobacter fetus	P35827	AAO64227.1	9851986
SS02239	frpA	FrpA (Reference); Iron-regulated protein FrpA (UniProt, NCBI)	Neisseria meningitidis	P55126	P55126.1	20528947
SS02240	frpC	Iron-regulated protein FrpC (UniProt, NCBI)	Neisseria meningitidis	P55127	P55127.1	11500424
SS02241	apxIA	ApxIA (Reference); RTX-I toxin determinant A from serotypes 1/9 (UniProt)	Actinobacillus pleuropneumoniae	P55128	P55128.1	20528947
SS02242	apxIIIA	ApxIIIA (Reference); RTX-III toxin determinant A from serotype 2 (UniProt)	Actinobacillus pleuropneumoniae	P55130	P55130.1	20528947
SS02243	mchB	Microcin H47 (UniProt, NCBI)	Escherichia coli	P62530	AOM43078.1	11181394
SS02244	prtA	Protease PrtA (NCBI)	Photorhabdus sp.	P82115	P82115.2	15049334;12777498
SS02245	aprA	AprA (Reference); serralysin family metalloprotease AprA (NCBI)	Pseudomonas aeruginosa	Q03023	WP_003082542.1	20528947
SS02246	prtG	PrtG (Reference); Serralysin G (UniProt)	Dickeya chrysanthemi	Q07162	CAA50501.1	20528947
SS02247	prtA	PrtA (Reference); Serralysin A (UniProt)	Dickeya chrysanthemi	Q07295	CAA49611.1	20528947
SS02248	zapA	ZapA (Reference); Serralysin (UniProt)	Proteus mirabilis	Q11137	Q11137.1	20528947
SS02249	algE4	Mannuronan C5-epimerase AlgE4 (UniProt)	Azotobacter vinelandii	Q44493	Q44493.1	16855245
SS02250	mtfS	Microcin-24 (UniProt)	Escherichia coli	Q46971	Q46971.1
SS02251	hasA	HasA (Reference); Hemophore HasA (UniProt)	Serratia marcescens	Q54450	1B2V_A	20528947;15546664
SS02252	paxA	PaxA (Reference); Exotoxin PaxA (UniProt, NCBI)	Pasteurella aerogenes	Q9RCG8	Q9RCG8.1	20528947
SS02253	mcjA	Microcin J25 (UniProt)	Escherichia coli	Q9X2V7	WP_001513516.1	15866933
SS02254	mceA	Microcin E492 (UniProt, NCBI)	Klebsiella pneumoniae	Q9Z4N4	Q9Z4N4.2	16569859
SS02255	algE7	Alginate lyase 7 (UniProt)	Azotobacter vinelandii	Q9ZFG9	WP_012703560.1	16855245
SS02256	prtA	Protease PrtA (UniProt, NCBI)	Pseudomonas fluorescens	Q9ZG96	AAD09851.1	10074078
SS02257	tliA	Thermostable lipase TliA (UniProt)	Pseudomonas fluorescens	Q9ZG91	AAD09856.1	17555839;20528947
SS02258	XF_0668	Hemolysin-type calcium binding protein (UniProt, NCBI)	Xylella fastidiosa	Q9PFI9	AAF83478.1	17427810
SS02259	XF_1011	Hemolysin-type calcium binding protein (UniProt, NCBI)	Xylella fastidiosa	Q9PEL7	AAF83821.1	17427810
SS02260	XF_2407	Bacteriocin (UniProt)	Xylella fastidiosa	Q9PAT8	WP_155114999.1	17427810
SS02261	XF_2759	Hemolysin-type calcium binding protein (UniProt)	Xylella fastidiosa	Q9P9W1	AAF85544.1	17427810
SS02262	eprC	Extracellular metalloprotease EprC (UniProt, NCBI)	Dickeya chrysanthemi	Q8GN31	AAN33118.1
SS02263	eprB	EprB (UniProt, NCBI)	Dickeya chrysanthemi	Q5D1L3	AAX13994.1
SS02264	aprAPF33	Alkaline protease (UniProt)	Pseudomonas fluorescens	Q9ZNJ1	QJI37777.1	10524213
SS02265	mll1028	Rhizobiocin RzcA (UniProt, NCBI)	Mesorhizobium loti	Q98LG7	BAB48496.1	15044436
SS02266	mll2585	Endo-1,3-1,4-beta-glycanase (UniProt)	Mesorhizobium loti	Q98I38	WP_010911029.1
SS02267	mll6750	Mll6750 protein (UniProt)	Mesorhizobium loti	Q988G6	WP_010914294.1
SS02268	hylA	Hemolysin (UniProt)	Aquifex aeolicus	O67179	WP_010880680.1
SS02269	rtxA	VcRtxA (Reference); RTX toxin RtxA (NCBI)	Vibrio cholerae	Q9KS12	AAF94608.1	20528947
SS02270	VC_A0849	hypothetical protein VC_A0849 (NCBI)	Vibrio cholerae	Q9KL97	AAF96747.1
SS02271	PA1245	hypothetical protein PA1245 (NCBI)	Pseudomonas aeruginosa	G3XCU0	NP_249936.1	20947426
SS02272	PA1874	BapA prefix-like domain-containing protein (NCBI)	Pseudomonas aeruginosa	Q9I2M3	WP_003147473.1
SS02273	NMA1625	Putative RTX family exoprotein (UniProt)	Neisseria meningitidis	A0A0U1RJD8	WP_002246250.1	17133369
SS02274	SY94_3563	Endo-beta-1,3-glucanas (UniProt)	Rhizobium radiobacter	A0A083ZK36	WP_010973145.1
SS02275	SMc01182	Hypothetical protein SM2011_c01182 (NCBI)	Sinorhizobium meliloti	Q92KC8	AGG74195.1
SS02276	SMc00286	Calcium-binding protein (UniProt, NCBI)	Sinorhizobium meliloti	Q92KB8	WP_010969418.1
SS02277	SMc04171	SMc04171 (Reference); Hemolysin-type calcium-binding protein (UniProt, NCBI)	Sinorhizobium meliloti	Q92NZ9	AGG74589.1
SS02278	SMc04206	Putative hemolysin-type calcium-binding protein (UniProt, NCBI)	Sinorhizobium meliloti	Q92K62	AGG74624.1	11481430
SS02279	SMc03108	Calcium-binding protein (UniProt, NCBI)	Sinorhizobium meliloti	Q92LP8	WP_010970335.1
SS02280	YPO3973	Metalloprotease (UniProt)	Yersinia pestis	A0A384L523	WP_002228165.1
SS02281	sapA	Secreted protease sapA (UniProt)	Caulobacter vibrioides	A0A0H3C6K3	ATC27586.1	22588222
SS02282	rsaA	RsaA (Reference); S-layer protein RsaA (NCBI)	Caulobacter vibrioides	P35828	WP_024265658.1	22588222;20528947
SS02283	CC_2075	hypothetical protein CC_2075 (NCBI)	Caulobacter vibrioides	Q9A6L8	AAK24046.1
SS02284	CC_2610	Calcium-binding protein (UniProt)	Caulobacter vibrioides	Q9A554	YP_002518066.2
SS02285	SMa0034	Serralysin-like metalloprotease (UniProt)	Sinorhizobium meliloti	Q931C8	WP_010967016.1
SS02286	eglC	Endo-1,3-1,4-beta-glycanase EglC (UniProt)	Sinorhizobium meliloti	Q9Z3Q2	Q9Z3Q2.2
SS02287	SMa2111	hypothetical protein SMa2111 (NCBI)	Sinorhizobium meliloti	Q92XT9	AAK65809.2
SS02288	SM_b20079	SMb20079 (Reference); Probable type I secretion target repeat protein (UniProt)	Sinorhizobium meliloti	Q92X83	ASP61663.1
SS02289	SM_b20829	Putative secreted calcium-binding protein (UniProt, NCBI)	Sinorhizobium meliloti	Q92VX5	AGG71584.1
SS02290	SM_b21229	Putative calcium-binding exported protein (UniProt, NCBI)	Sinorhizobium meliloti	Q92VH1	WP_010975596.1
SS02291	wgeA	Putative Ca2+-binding protein WgeA (Formerly ExpE1) (UniProt)	Sinorhizobium meliloti	Q7ANQ3		18533835
SS02292	SM_b21543	Putative hemolysin-adenlyate cyclase protein (UniProt)	Sinorhizobium meliloti	Q92UV3	WP_010975828.1	19395488
SS02293	exsH	Endo-1,3-1,4-beta-glycanase ExsH (UniProt, NCBI)	Sinorhizobium meliloti	O33680	WP_010975894.1	18533835
SS02294	frpC	Iron-regulated protein (UniProt, NCBI)	Synechocystis sp.	P73019	BAL28210.1	30394639;29678468
SS02295	slr1403	Slr1403 protein (UniProt)	Synechocystis sp.	P73590	WP_010872264.1
SS02296	sll1951	S-layer protein (UniProt)	Synechocystis sp.	P73817	BAL29042.1	16672608
SS02297	sll0723	Sll0723 protein (UniProt)	Synechocystis sp.	P74647	WP_010874244.1	29678468
SS02298	sll0721	Leukotoxin LtA (UniProt, NCBI)	Synechocystis sp.	P74649	AGF53314.1	25239498
SS02299	all0274	All0274 protein (UniProt)	Nostoc sp.	Q8Z029	WP_010994451.1
SS02300	alr0276	Alr0276 protein (UniProt)	Nostoc sp.	Q8Z027	WP_010994453.1
SS02301	alr0290	Alr0290 protein (UniProt)	Nostoc sp.	Q8Z013	WP_010994467.1
SS02302	all0364	All0364 protein (UniProt)	Nostoc sp.	Q8YZU3	WP_010994540.1
SS02303	alr0791	Outer membrane secretion protein (UniProt, NCBI)	Nostoc sp.	Q8YYQ5	BAB72748.1
SS02304	alr1403	Alr1403 protein (UniProt)	Nostoc sp.	Q8YX15	BAB73360.1
SS02305	all2654	All2654 protein (UniProt)	Nostoc sp.	Q8YTQ9	WP_010996810.1
SS02306	all2655	All2655 protein (UniProt)	Nostoc sp.	Q8YTQ8	BAB74354.1
SS02307	all2793	All2793 protein (UniProt)	Nostoc sp.	Q8YTC9	BAB74492.1
SS02308	all3346	All3346 protein (UniProt)	Nostoc sp.	Q8YRU7	WP_010997497.1
SS02309	alr3659	Alr3659 protein (UniProt)	Nostoc sp.	Q8YR01	WP_010997803.1
SS02310	alr4072	Alr4072 protein (UniProt)	Nostoc sp.	Q8YPW8	WP_010998212.1
SS02311	alr4238	Alr4238 protein (UniProt)	Nostoc sp.	Q8YPF6	BAB75937.1
SS02312	all7128	All7128 protein (UniProt)	Nostoc sp.	Q8YL10	WP_010999685.1
SS02313	alr7304	Alr7304 protein (UniProt)	Nostoc sp.	Q8YKJ3	BAB78388.1
SS02314	RSc0102	Putative calcium binding hemolysin protein (UniProt)	Ralstonia solanacearum	Q8Y378	CAD13630.1	15283662
SS02315	RSc0104	Putative hemolysin-type calcium-binding protein (UniProt, NCBI)	Ralstonia solanacearum	Q8Y377	CAD13632.1	15283662
SS02316	RSc0246	Putative calcium binding hemolysin protein (UniProt, NCBI)	Ralstonia solanacearum	Q8Y2T6	CAD13774.1	15283662
SS02317	RSc0249	Putative calcium binding hemolysin protein (UniProt)	Ralstonia solanacearum	Q8Y2T5	WP_011000216.1	15283662
SS02318	RSp0294	Putative hemolysin-type calcium-binding protein (UniProt, NCBI)	Ralstonia solanacearum	Q8XT21	CAD17445.1	15283662
SS02319	RSp0295	Putative hemolysin-type protein (UniProt, NCBI)	Ralstonia solanacearum	Q8XT20	CAD17446.1	15283662
SS02320	RSp1180	Probable hemagglutinin/hemolysin-related protein (UniProt)	Ralstonia solanacearum	Q8XQP2	WP_011004466.1	15283662
SS02321	XAC1918	Hemolysin related protein (UniProt)	Xanthomonas axonopodis	Q8PL85	AJY82038.1	15808747
SS02322	XAC2197	Hemolysin-type calcium binding protein (UniProt)	Xanthomonas axonopodis	Q8PKH6	AAM37050.1	15808747;10910347
SS02323	XAC2198	Hemolysin-type calcium binding protein (UniProt)	Xanthomonas axonopodis	Q8PKH5	AAM37051.1	15808747;10910347
SS02324	bpfA	Biofilm-promoting protein BpfA (UniProt)	Shewanella oneidensis	Q8E9G6	WP_011073976.1	24626808
SS02325	PP_0168	Putative surface adhesion protein (UniProt)	Pseudomonas putida	Q88RG2		15546664
SS02326	PP_2561	Putative secreted hemolysin-type calcium-binding bacteriocin (UniProt, NCBI)	Pseudomonas putida	Q88JT6	AAN68170.2	23766110
SS02327	PP_3849	Putative calcium-binding protein, hemolysin-type (UniProt)	Pseudomonas putida	Q88G76	WP_138868012.1
SS02328	PP_4924	Serine protease, subtilase family (UniProt)	Pseudomonas putida	Q88DA3
SS02329	bll3109	Bll3109 protein (UniProt)	Bradyrhizobium diazoefficiens	Q89QL5	WP_011085893.1
SS02330	bll3563	Bll3563 protein (UniProt, NCBI)	Bradyrhizobium diazoefficiens	Q89PB9	BAC48828.1
SS02331	bll3714	Bll3714 protein (UniProt)	Bradyrhizobium diazoefficiens	Q89NW9
SS02332	blr5821	Blr5821 protein (UniProt)	Bradyrhizobium diazoefficiens	Q89I18	WP_011088564.1
SS02333	bll6027	Bll6027 protein (UniProt)	Bradyrhizobium diazoefficiens	Q89HG4	WP_011088768.1
SS02334	bll7792	Bll7792 protein (UniProt, NCBI)	Bradyrhizobium diazoefficiens	Q89CK5	BAC53057.1
SS02335	PSPTO_3193	Metalloprotease, putative (UniProt)	Pseudomonas syringae	Q880G6	WP_011104426.1
SS02336	PSPTO_3332	Alkaline metalloendoprotease (UniProt)	Pseudomonas syringae	Q87ZU2	KKI27598.1
SS02337	PSPTO_4084	Mannuronan C-5-epimerase, putative (UniProt)	Pseudomonas syringae	Q87XU1	WP_011104868.1
SS02338	NE0161	Hemolysin-type calcium-binding region:RTX N-terminal domain (UniProt)	Nitrosomonas europaea	Q82XT8	WP_011110808.1
SS02339	BPP0974	Putative hemolysin (UniProt)	Bordetella parapertussis	Q7WBN0	WP_010927777.1
SS02340	BB1186	Putative hemolysin (UniProt)	Bordetella bronchiseptica	A0A0H3LIZ4	WP_010926070.1	29866808
SS02341	PMT_0256	Hemolysin-type calcium-binding region:RTX N-terminal domain (UniProt, NCBI)	Prochlorococcus marinus	Q7V8S5	CAE20431.1
SS02342	PMT_0372	Hemolysin-type calcium-binding protein (UniProt, NCBI)	Prochlorococcus marinus	Q7V8H5	CAE20547.1
SS02343	PMT_0929	Hemolysin-type calcium-binding region:RTX N-terminal domain (UniProt, NCBI)	Prochlorococcus marinus	Q7V733	CAE21104.1
SS02344	swmA	Cell-surface-associated polypeptide SwmA (UniProt)	Synechococcus sp.	Q7UA16	JC6140	20528947
SS02345	SYNW0196	Putative alkaline phosphatase (UniProt)	Synechococcus sp.	Q7U9Q7	WP_011127072.1
SS02346	expE1	Putative secreted calcium-binding protein (UniProt, NCBI)	Synechococcus sp.	Q7U7J8	CAE07499.1
SS02347	SYNW1908	Possible Zn-dependent metalloprotease (UniProt, NCBI)	Synechococcus sp.	Q7U504	CAE08423.1
SS02348	SYNW2293	Possible hemolysin-type calcium-binding protei (UniProt, NCBI)	Synechococcus sp.	Q7U3Y4	CAE08808.1
SS02349	SYNW2304	matrixin family metalloprotease (NCBI)	Synechococcus sp.	Q7U3X3	WP_011129157.1
SS02350	SYNW2390	Putative alkaline phosphatase/5' nucleotidase (UniProt)	Synechococcus sp.	Q7U3P0	CRY93428.1
SS02351	SYNW2409	Putative hemolysin-type calcium-binding protein similar to HlyA (UniProt, NCBI)	Synechococcus sp.	Q7U3M2	CAE08924.1
SS02352	CV_0311	Probable RTX (Repeat in structural toxin) (UniProt)	Chromobacterium violaceum	Q7P1A2	WP_011133866.1	15100995
SS02353	CV_0516	Probable calcium binding hemolysin (UniProt)	Chromobacterium violaceum	Q7P0Q0		15100995;24535738
SS02354	zapE	Putative metalloprotease (UniProt)	Proteus mirabilis	B4EUL6	WP_012367535.1
SS02355	apxIVA	ApxIVA (UniProt, Reference)	Actinobacillus pleuropneumoniae	C0M4V2	ACN76442.1	20528947
SS02356	plyA	PlyA (Reference); Polysaccharidase (UniProt)	Rhizobium leguminosarum	O05692	WP_018243215.1	16740954;20528947
SS02357	HasAp	HasAp (UniProt)	Pseudomonas aeruginosa	O69756	WP_003115011.1	20947426
SS02358	ehxA	EhxA (Reference); enterohemolysin EhxA (NCBI)	Escherichia coli	O85101	WP_032489272.1	20528947
SS02359	slaA	SlaA (Reference); Surface layer protein (UniProt)	Serratia marcescens	O87109	WP_099981710.1	20528947
SS02360	eprA	Metalloprotease (UniProt, NCBI)	Pseudomonas tolaasii	O87806	CAA07697.1
SS02361	lipA	Extracellular lipase (UniProt, NCBI)	Serratia marcescens	Q09KJ5	ABI83633.1	24129268;20528947
SS02362	plyB	Polysaccharidase secreted via PrsDE Type I exporter (UniProt)	Rhizobium leguminosarum	Q1MEW2	WP_011652539.1	16740954;20528947
SS02363	prtW	M10 family metallopeptidase (NCBI)	Pectobacterium atrosepticum	Q6D3F9	WP_011094320.1	15828685
SS02364		Alkaline protease (UniProt, NCBI)	Pseudomonas aeruginosa	Q6SQM7	AAR20883.1	3253732
SS02365	YPO3922	Hemophore HasA (UniProt, NCBI)	Yersinia pestis	A0A0H2W798	WP_002209484.1	11598042
SS02366	p1	Yrp1 (NCBI)	Yersinia ruckeri	Q93RN3	AFK08628.1	12101310;15240252
SS02367	lipA	LipA (UniProt, NCBI)	Pseudomonas brassicacearum	Q9KGS2	AAF87594.1	11222613;24865936
SS02368	aprA	AprA (UniProt, NCBI)	Pseudomonas brassicacearum	Q9KGS8	AAF87588.1	11222613
SS02369	rzcA	Rhizobiocin RzcA (UniProt)	Rhizobium leguminosarum	Q9LAE6		15044436
SS02370	hasA	heme acquisition protein HasA (NCBI)	Pseudomonas fluorescens	Q9RHT3	ESW55346.1	10601212
SS02371	prtA	zinc-binding metalloprotease PrtA (NCBI)	Erwinia amylovora	Q9XB65	EKV52237.1	20192826;20528947
SS02372	NMA1626	Putative RTX-family exoprotein (UniProt)	Neisseria meningitidis	A0A0U1RJD9
SS02373	SM_b20838	Calcium binding protein (UniProt, NCBI)	Sinorhizobium meliloti	Q92VW6	AGG71593.1
SS02374	rzcA	Rhizobiocin/RTX toxin (UniProt)	Agrobacterium tumefaciens		WP_035257655.1
SS02375	hlyA	HlyA (Reference); Hemolysin, plasmid (UniProt)	Proteus vulgaris	A0A0G4Q7T4		8302219
SS02376	CRX48_04650	HlyA (Reference); RTX toxin hemolysin A (UniProt, NCBI)	Morganella morganii	A0A2C5TL69	QCY21538.1	8302219
SS02377	ltxA	LtxA (Reference); RTX family leukotoxin LtxA (NCBI)	Aggregatibacter actinomycetemcomitans	P16462	WP_005567703.1	20200418;20528947
SS02378	ef0044	CylL (Reference, UniProt)	Enterococcus faecalis	Q7B9F5	EOE43258.1	8302219
SS02379	spaS	SpaS (Reference); Lantibiotic subtilin (UniProt)	Bacillus subtilis	P10946	WP_003220055.1	8302219
SS02380	spaN	Nisin (Reference); Lantibiotic nisin-A (UniProt)	Lactococcus lactis	P13068	ADZ63249.1	8302219
SS02381	epiA	EpiA (Reference); Lantibiotic epidermin (UniProt)	Staphylococcus epidermidis	P08136	WP_002498697.1	8302219
SS02382	pedA	PedA (Reference); Bacteriocin pediocin PA-1 (UniProt)	Pediococcus acidilactici	P29430	AAA98337.1	8302219
SS02383	lcnA	LcnA (Reference); Bacteriocin lactococcin-A (UniProt, NCBI)	Lactococcus lactis	P0A313	P0A312.1	8302219
SS02384	N/A	LcnG (Reference); Bacteriocin lactococcin-G subunit beta (UniProt)	Lactococcus lactis	P36962	WP_058212908.1	8302219
SS02385	gdmA	Gallidermin (Reference); Lantibiotic gallidermin (UniProt)	Staphylococcus gallinarum	P21838	WP_042739435.1	8302219
SS02386	mbxA	Cytotoxin (UniProt)	Moraxella bovis	Q93GI2	ABR28453.1	20528947
SS02387	aqxA	AqxA (UniProt)	Actinobacillus equuli	Q8KWZ9	AAM45566.1	20528947
SS02388	rtxA	RTX toxin RtxA (UniProt)	Vibrio vulnificus	A7DV97		20528947
SS02389	CMV05_06120	RTX toxin RtxA (UniProt)	Vibrio anguillarum	A0A290PLC2		20528947
SS02390	C9J66_04285	Type I secretion C-terminal target domain-containing protein (UniProt)	Vibrio cholerae	A0A2V4NK47		20528947
SS02391	aprX	Metalloprotease AprX (UniProt)	Pseudomonas fluorescens	A0A1T2ZEG4	PQA98933.1	20528947
SS02392	rtxA	2-aminoethylphosphonate--pyruvate transaminase (UniProt)	Bradyrhizobium elkanii	Q93HS5	BAB55900.1	20528947
SS02393	rtxA	RtxA (UniProt)	Xanthomonas oryzae	Q5H327	WP_011258200.1	20528947
SS02394	rzcA	Rhizobiocin/RTX toxin (UniProt)	Agrobacterium tumefaciens	Q7CUW1	WP_010973826.1	20528947
SS02395	crs	S-layer protein (UniProt, NCBI)	Campylobacter rectus	O30524	AAC46210.1	20528947
SS02396	csxA	S-layer-RTX protein (UniProt, NCBI)	Campylobacter rectus	Q9ZIB3	AAD02005.1	20528947
SS02397	csxB	S-layer-RTX protein (UniProt, NCBI)	Campylobacter rectus	Q9ZIB5	AAD02003.1	20528947
SS02398	N/A	Oscillin (UniProt, NCBI)	Phormidium uncinatum	O51813	AAC46039.1	20528947
SS02399	algE1	Mannuronan C5-epimerase AlgE1 (UniProt, NCBI)	Azotobacter vinelandii	Q44494	Q44494.1	16855245
SS02400	algE2	Mannuronan C5-epimerase AlgE2 (UniProt, NCBI)	Azotobacter vinelandii	Q44495	Q44495.1	16855245
SS02401	algE3	Mannuronan C5-epimerase AlgE3 (UniProt)	Azotobacter vinelandii	Q44496		16855245
SS02402	algE5	Mannuronan C5-epimerase AlgE5 (UniProt)	Azotobacter vinelandii	Q44492	Q44492.1	16855245
SS02403	algE6	Mannuronan C5-epimerase AlgE6 (UniProt)	Azotobacter vinelandii	Q9ZFH0	Q9ZFH0.1	16855245
SS02404	frpC	Bacteriocin (UniProt, NCBI)	Xylella fastidiosa	Q87BM1	AAO29274.1	17427810
SS02405	XF_0175	Hemolysin III protein (UniProt)	Xylella fastidiosa	Q9PGX3	ETE35852.1	17427810
SS02406	XF_0984	Gamma-glutamyltranspeptidase (UniProt)	Xylella fastidiosa	Q9PEP4	ARO69252.1	17427810
SS02407	XF_1280	Uncharacterized protein (UniProt)	Xylella fastidiosa	Q9PDU9		17427810
SS02408	metF	Methylenetetrahydrofolate reductase (UniProt)	Xylella fastidiosa	Q87EA5	AAO28292.1	17427810
SS02409	PD_0282	membrane protein insertion efficiency factor YidD (NCBI)	Xylella fastidiosa	Q87EM1	WP_011097572.1	17427810
SS02410	tlyC	Hemolysin (UniProt, NCBI)	Xylella fastidiosa	Q87DZ3	AAO28409.1	17427810
SS02411	PD_1506	Hemolysin-type calcium binding protein (UniProt, NCBI)	Xylella fastidiosa	Q87BF0	ADN62349.1	17427810
SS02412	frpC	Hemolysin-type calcium binding protein (UniProt, NCBI)	Xylella fastidiosa	Q87EK2	hemolysin-type calcium binding protein	17427810
SS02413	frpC	Hemolysin-type calcium binding protein (UniProt)	Xylella fastidiosa	Q879U6	EGO81411.1	17427810
SS02414	frpC	Hemolysin-type calcium binding protein (UniProt)	Xylella fastidiosa	Q879U3	WP_011098373.1	17427810
SS02415	XF_0262	Colicin V (UniProt)	Xylella fastidiosa	Q9PGN6	AAF83075.1	17427810
SS02416	XF_0263	Colicin V (UniProt)	Xylella fastidiosa	Q9PGN5	AAF83076.1	17427810
SS02417	cvaC	Colicin V (UniProt)	Xylella fastidiosa	Q87ET3	ACB91659.1	17427810
SS02418	PD_0216	Colicin V (UniProt)	Xylella fastidiosa	Q87ET2	ADN63209.1	17427810
SS02419	lipAPF33	Extracellular lipase (UniProt, NCBI)	Pseudomonas fluorescens	Q9ZNI4	BAA36468.1	10524213
SS02421	pueB	PueB (Reference); Polyurethanase B (UniProt)	Pseudomonas chlororaphis	Q9R9H2	AAF01331.1	18045391

T2SS substrate

Top

BastionHub ID	Gene Name	Brief Description	Species	UniProt ID	NCBI ID	PubMed ID
SS02143	lasB	LasB (Reference); M4 family elastase LasB (NCBI)	Pseudomonas aeruginosa	P14756	WP_003113835.1	9642203
SS02144	plcH	PlcH (Reference); Hemolytic phospholipase C (UniProt, NCBI)	Pseudomonas aeruginosa	P06200	P06200.2	11726509
SS02145	lasA	LasA (Reference); Protease LasA (UniProt)	Pseudomonas aeruginosa	P14789	AAA25873.1	9642203
SS02146	plcN	PlcN (Reference); Non-hemolytic phospholipase C (UniProt)	Pseudomonas aeruginosa	P15713	WP_003113149.1	11726509
SS02147	plcB	PlcB (Reference); Phospholipase C, PlcB (UniProt)	Pseudomonas aeruginosa	Q9I7A4	NP_248716.1	15306013
SS02148	cbpD	CbpD (Reference); Chitin-binding protein CbpD (UniProt, NCBI)	Pseudomonas aeruginosa	Q9I589	WP_003114231.1	10671445
SS02149	eta	ToxA (Reference); Exotoxin A (UniProt, NCBI)	Pseudomonas aeruginosa	P11439	WP_003112478.1	7901198
SS02150	impA	IMPa (Reference); Immunomodulating metalloprotease (UniProt)	Pseudomonas aeruginosa	Q9I5W4	NP_249263.1	20947426
SS02151	prpL	PrpL (Reference); Lysyl endopeptidase (UniProt, NCBI)	Pseudomonas aeruginosa	Q9HWK6	Q9HWK6.1	18203852
SS02152	lipA	LipA (Reference); Triacylglycerol lipase (UniProt, NCBI)	Pseudomonas aeruginosa	P26876	WP_048521053.1	7946464
SS02153	lipC	LipC (Reference); Lipase LipC (UniProt)	Pseudomonas aeruginosa	Q9HUZ7		10564475
SS02154	phoA	PhoA (Reference); Alkaline phosphatase H (UniProt, NCBI)	Pseudomonas aeruginosa	P35483	P35483.2	3138529
SS02155	lap	PaAP (Reference); Aminopeptidase Y (Arg, Lys, Leu preference) (NCBI)	Pseudomonas aeruginosa	Q9HZQ8	EYT99895.1	9642203
SS02156	loxA	LoxA (Reference); Lipoxygenase LoxA (UniProt)	Pseudomonas aeruginosa	Q9I4G8	ERW27709.1	14766977
SS02157	PA2377	ABC transporter substrate-binding protein (NCBI)	Pseudomonas aeruginosa	Q9I1A2	WP_003122690.1	26341027
SS02158	eddA	Extracelullar DNA degradation protein, EddA (UniProt)	Pseudomonas aeruginosa	Q9HXA3	AGV61862.1	26341027
SS02159	PA4140	FAD-binding PCMH-type domain-containing protein (UniProt)	Pseudomonas aeruginosa	Q9HWP1	NP_252829.1	26341027
SS02160	PA2783	Mep72 (Reference); CBM-cenC domain-containing protein (UniProt)	Pseudomonas aeruginosa	Q9I060	NP_251473.1	25488299
SS02161	glpQ	GlpQ (Reference); Glycerophosphoryl diester phosphodiesterase, periplasmic (UniProt)	Pseudomonas aeruginosa	Q9I6E6		19028883
SS02162	phoA2	LapA (Reference); Alkaline phosphatase L (UniProt)	Pseudomonas aeruginosa	P35482		11985723
SS02163	PA0689	LapB (Reference); hypothetical protein PA0689 (NCBI)	Pseudomonas aeruginosa	Q9I5N7	NP_249380.1	11985723
SS02164	phoA2	LapC (Reference); Alkaline phosphatase L (UniProt, NCBI)	Pseudomonas aeruginosa	Q02HI0	Q02HI0.1	11985723
SS02165	cbpE	CbpE(CbpD) (Reference); CbpE (UniProt)	Pseudomonas aeruginosa	A6V168	WP_012074647.1	24748613
SS02166	plaC	PlaC (Reference); Glycerophospholipid:cholesterol acyltransferase (UniProt)	Legionella pneumophila	Q5DJS6	AAW66486.1	15845496
SS02167	lpg1385	NttA (Reference); hypothetical protein lpg1385 (NCBI)	Legionella pneumophila	Q5ZVQ5	AAU27467.1	23429532
SS02168	proA	ProA (Reference); type II secretion system effector ProA, partial (NCBI)	Legionella pneumophila		CCC42092.1	18083880
SS02169	lpg2848	SrnA (Reference); Ribonuclease, T2 family (UniProt, NCBI)	Legionella pneumophila	Q5ZRN2	AAU28896.1	19246759
SS02170	lpg2622	NttB (Reference); hypothetical protein lpg2622 (NCBI)	Legionella pneumophila	Q5ZS97	AAU28680.1	23429532
SS02171	legP	LegP (Reference); Dot/Icm T4SS effector LegP (NCBI)	Legionella pneumophila	Q5ZR84	WP_010948683.1	23429532
SS02172	chiA	ChiA (Reference); putative bifunctional chitinase/lysozyme precursor (NCBI)	Legionella pneumophila		AMV15035.1	17148602
SS02173	map	Map (Reference); Acid phosphatase (UniProt)	Legionella pneumophila	Q9APF7	WP_027265797.1	11119504
SS02174	plaA	PlaA (Reference); lysophospholipase A (NCBI)	Legionella pneumophila		AAN63820.1	12379686
SS02175	plcA	PlcA (Reference); putative phospholipase C (NCBI)	Legionella pneumophila		AAM73854.1	12101309
SS02176		Lpg2622 (Reference); C1 family peptidase (NCBI)	Legionella pneumophila		WP_010948322.1	19722835
SS02177		Lpg1918 (Reference); cellulase family glycosylhydrolase (NCBI)	Legionella pneumophila		WP_010947635.1	19722835
SS02178		DUF1566 domain-containing protein(NCBI); Lpg2644 (Reference)	Legionella pneumophila		WP_010948344.1	19722835
SS02179		Lpg1809 (Reference); hypothetical protein (NCBI)	Legionella pneumophila		WP_010947535.1	19722835
SS02180		Lpg1385 (Reference); hypothetical protein (NCBI)	Legionella pneumophila		WP_010947115.1	19722835
SS02181		Lpg0873 (Reference); hypothetical protein (NCBI)	Legionella pneumophila		WP_010946609.1	19722835
SS02182		Lpg0189 (Reference); Lpg0189 family type II secretion system effector (NCBI)	Legionella pneumophila		WP_010945950.1	19722835
SS02183		Lpg0956 (Reference); DUF4785 family protein (NCBI)	Legionella pneumophila		WP_010946691.1	19722835
SS02184		Lpg0264 (Reference); N-acetylmuramoyl-L-alanine amidase (NCBI)	Legionella pneumophila		WP_010946025.1	19722835
SS02185		Lpg1832 (Reference); VirK family protein (NCBI)	Legionella pneumophila		WP_010947558.1	19722835
SS02186		GamA (Reference); hypothetical protein lpp0489 (NCBI)	Legionella pneumophila		CAH11637.1	20965781
SS02187	chiY	ChiY (Reference); ChiY protein (NCBI)	Yersinia enterocolitica		CAC83040.2	19968791
SS02188	chiA	ChiA (Reference); Probable bifunctional chitinase/lysozyme (NCBI)	Escherichia coli		P13656.2	10760150
SS02189	yghJ	SslE (Reference); putative lipoprotein YghJ (NCBI)	Escherichia coli		YP_026189.1	22451516
SS02190	eltA	LptA(EltA) (Reference); heat-labile enterotoxin A chain precursor (lt-a, porcine) (ltp-a) (plasmid) (NCBI)	Escherichia coli		CBJ04426.1	12011463
SS02191	yghJ	YghJ (Reference); Putative lipoprotein YghJ (NCBI)	Escherichia coli		E3PJ90.1	24478067
SS02192	cpI	CPI (Reference); Haloprotease CPI (UniProt)	Pseudoalteromonas ruthenica	C5J5F5	CAR94714.1	19376897
SS02193	lipA	LipA (Reference); lipase (NCBI)	Acinetobacter baumannii		ABW70205.1	26668261
SS02194		LipAN (Reference); hypothetical protein A1S_3473 (plasmid) (NCBI)	Acinetobacter baumannii		ABO13862.1	27713027
SS02195		CpaA (Reference); metallopeptidase (NCBI)	Acinetobacter nosocomialis		ERL68477.1	26764912
SS02196		LipH (Reference); alpha/beta hydrolase (NCBI)	Acinetobacter nosocomialis		ERL68190.1	26764912
SS02197	aerA	AerA (Reference); Aerolysin (NCBI)	Aeromonas hydrophila		P09167.2	3584074
SS02198		BURPS688_3454 (Reference); serine carboxypeptidase family protein (NCBI)	Burkholderia pseudomallei		ABN81427.1	16518399
SS02199		BURPS688_1221 (Reference); conserved hypothetical protein (NCBI)	Burkholderia pseudomallei		ABN84437.1	16518399
SS02200	plcN_2	BURPS688_0358 (Reference); non-hemolytic phospholipase C (NCBI)	Burkholderia pseudomallei		ABN81562.1	16518399
SS02201	ctxB	VC1456-57 ctxAB (Reference); cholera enterotoxin binding subunit CtxB (NCBI)	Vibrio cholerae	Q56635	WP_000593522.1	7704895
SS02202		cholera enterotoxin, A subunit (NCBI)	Vibrio cholerae		AAF94614.1	7704895
SS02203	hap	VCA0865 (Reference); hemagglutinin/proteinase HapA (NCBI)	Vibrio cholerae	P24153	WP_000782181.1	6417020
SS02204	VC1784	VC1784 (Reference); exo-alpha-sialidase (NCBI)	Vibrio cholerae		WP_001889713.1	1730470
SS02205	hlyA	VCA0219 (Reference); cytolysin and hemolysin HlyA Pore-forming toxin (NCBI)	Vibrio cholerae	P09545	ACQ62004.1	19333391
SS02206	gbpA	VCA0811 (Reference); GlcNAc-binding protein A (UniProt)	Vibrio cholerae	A6XA54	KKP10811.1	14983042
SS02207	VC_A0812	VCA0812 (Reference); Leucine aminopeptidase-related protein (UniProt)	Vibrio cholerae	Q9KLD4	WP_001890356.1	8890197
SS02208	VC_A0813	VCA0813 (Reference); Aminopeptidase (UniProt)	Vibrio cholerae	Q9KLD3	WP_001037204.1	21385872
SS02209	VC_0930	VC0930 (Reference); Hemolysin-related protein (UniProt)	Vibrio cholerae	Q9KTH2	ACQ61564.1	17220218
SS02210	VC_A0803	VCA0803 (Reference); GlyGly-anchored extracellular serine protease VesA (NCBI)	Vibrio cholerae	Q9KLE3	WP_001233647.1	21385872
SS02211	VC_1200	VC1200 (Reference); GlyGly-anchored extracellular serine protease VesB (NCBI)	Vibrio cholerae	Q9KSQ6	WP_000554395.1	21385872
SS02212	VC_1649	VC1649 (Reference); GlyGly-anchored extracellular serine protease VesC (NCBI)	Vibrio cholerae	Q9KRJ1	WP_001043985.1	20927349
SS02213	VC_A0148	VCA0148 (Reference); TagA-related protein (UniProt, NCBI)	Vibrio cholerae	Q9KN18	AAF96061.1	21385872
SS02214	VC_1952	VC1952 (Reference); chitinase A domain protein (NCBI)	Vibrio cholerae	Q9KQP6	EGQ97456.1	14983042
SS02215	VC_A0027	VCA0027 (Reference); chitinase A (NCBI)	Vibrio cholerae	Q9KND8	EGR00745.1	14983042
SS02216	cod	chitin oligosaccharide deacetylase (NCBI)	Vibrio cholerae		WP_001881046.1	14983042
SS02217		VC0769 (Reference); chitinase, putative (NCBI)	Vibrio cholerae		AAF93934.1	14983042
SS02218		VCA0140 (Reference); lytic polysaccharide monooxygenase (NCBI)	Vibrio cholerae		WP_001882986.1	14983042
SS02219		VCA0738 (Reference); hypothetical protein VC_A0738 (NCBI)	Vibrio cholerae		AAF96637.1	21385872
SS02220		VC2298 (Reference); lipoprotein, putative (NCBI)	Vibrio cholerae		AAF95442.1	21385872
SS02221	prtV	PrtV (Reference); Pre-pro-metalloprotease PrtV (UniProt)	Vibrio cholerae	Q9KMU6	WP_002033169.1	26222047
SS02222	pehA	PehA (Reference); Endo-polygalacturonase (UniProt)	Pectobacterium atrosepticum	Q6D880	ACX89060.1	11929517
SS02223	pelB	PelC (Reference); pectate lyase (NCBI)	Dickeya chrysanthemi		CAA47821.1	10922032
SS02224		Cel5 (Reference); Chain C, Cellulase Cel5 From Erwinia Chrysanthemi, A Family Gh 5-2 Enzyme (NCBI)	Dickeya chrysanthemi		1EGZ_C	11501995
SS02225	pnlH	PnlH (Reference); Pectate lyase (UniProt)	Dickeya dadantii	E0SG38	ADM98893.1	18643934

T3SS substrate

Top

BastionHub ID	Gene Name	Brief Description	Species	UniProt ID	NCBI ID	PubMed ID
SS00001	hopZ2	Type III effector HopZ2 (UniProt)	Pseudomonas amygdali	A0FDW2	WP_005746524.1	26120140
SS00002	hopZ2	Type III effector HopZ2 (UniProt, NCBI)	Pseudomonas coronafaciens	A0FDW6	ABK13721.1	26120140
SS00003	hopZ2	Type III effector HopZ2 (UniProt, NCBI)	Pseudomonas syringae	A0FDW7	ABK13722.1	26120140
SS00004	hopZ2	Type III effector HopZ2 (UniProt)	Pseudomonas amygdali	A0FDW8	WP_081026843.1	22230763
SS00005	hopZ2	Type III effector HopZ2 (UniProt)	Pseudomonas syringae	A0FDX1	WP_003407175.1	26120140
SS00006	aexT	AexT (UniProt)	Aeromonas veronii	A0FKE4	WP_031227428.1	17656370
SS00007		AexU (UniProt, Reference)	Aeromonas veronii	A0FKE5	WP_021229262.1	19534604
SS00008	YE3534	putative yspA (NCBI)	Yersinia enterocolitica	A1JQ83	AJJ23947.1	24391954
SS00009	yopT1	Cysteine protease yopT1 (UniProt)	Yersinia enterocolitica	A1JU65	WP_011117629.1	24391954
SS00010	yopM	Yop type III secretion system effector protein (UniProt)	Yersinia enterocolitica	A1JU68	WP_011117630.1	29891548
SS00011	yscX	Yop proteins translocation protein X (UniProt)	Yersinia enterocolitica	A1JU78	WP_002212969.1	24391954
SS00012	YEP0050	T3SS effector protein-tyrosine-phosphatase YopH (NCBI)	Yersinia enterocolitica	A1JUA6	WP_011117644.1	24391954
SS00013	YEP0053	type III secretion system effector GTPase activator YopE (NCBI)	Yersinia enterocolitica	A1JUA9	WP_011117646.1	24391954
SS00014	yopO	type III secretion system gatekeeper subunit MxiC (NCBI)	Yersinia enterocolitica	A1JUC4	WP_011100759.1	24391954
SS00015	nleA1	NleA1 protein (UniProt)	Escherichia coli	A1KWP2	WP_024238215.1	17553972
SS00016	nleA2	NleA2 protein (UniProt, NCBI)	Escherichia coli	A1KWP3	CAM11314.1	17553972
SS00017	nleA3	NleA3 protein (UniProt)	Escherichia coli	A1KWP4	WP_045903964.1	17553972
SS00018	nleA4	NleA4 protein (UniProt, NCBI)	Escherichia coli	A1KWP5	CAM11316.1	17553972
SS00019	nleA5	NleA5 protein (UniProt)	Escherichia coli	A1KWP6	WP_033810147.1	17553972
SS00020	nleA6-1	NleA6-1 protein (UniProt, NCBI)	Escherichia coli	A1KWP7	CAM11318.1	17553972
SS00021	nleA6-2	NleA6-2 protein (UniProt, NCBI)	Escherichia coli	A1KWP8	CAM11319.1	17553972
SS00022	nleA7	NleA7 protein (UniProt, NCBI)	Escherichia coli	A1KWP9	CAM11320.1	17553972
SS00023	nleA8-1	NleA8-1 protein (UniProt)	Escherichia coli	A1KWQ0	WP_001025664.1	17553972
SS00024	nleA8-2	NleA8-2 protein (UniProt)	Escherichia coli	A1KWQ1	WP_001025663.1	17553972
SS00025	nleA9	NleA9 protein (UniProt, NCBI)	Escherichia coli	A1KWQ2	CAM11323.1	17553972
SS00026	nleA10	NleA10 protein (UniProt, NCBI)	Escherichia coli	A1KWQ3	CAM11324.1	17553972
SS00027	nleA11	NleA11 protein (UniProt)	Escherichia coli	A1KWQ4	AET12018.1	17553972
SS00028	tccP	Tir-cytoskeleton coupling protein TccP (NCBI)	Escherichia coli	A2A0W5	WP_010917831.1	26120140
SS00029	tccP	Tir-cytoskeleton coupling protein TccP (NCBI)	Escherichia coli	A2A0W7	WP_171877906.1	24391954
SS00030	tccP2	Tir-cytoskeleton coupling protein TccP2 (NCBI)	Escherichia coli	A2A0X2	WP_107686092.1	26120140
SS00031	tccP2	Tir-cytoskeleton coupling protein TccP2 (NCBI)	Escherichia coli	A2A0X3	WP_052912734.1	19390696
SS00032	tccP2	Type III secreted effector protein (UniProt, NCBI)	Escherichia coli	A2A0X5	BAF45440.1	26120140
SS00033	tccP2	Type III secreted effector protein (UniProt)	Escherichia coli	A2A0X8	WP_012817749.1	26120140
SS00034	tccP2	Type III secreted effector protein (UniProt)	Escherichia coli	A2A0Y3	WP_012817749.1	26120140
SS00035	tccP2	Tir-cytoskeleton coupling protein TccP2 (NCBI)	Escherichia coli	A2A0Y6	WP_012817858.1	26120140
SS00036	tccP2	Type III effector (UniProt, NCBI)	Escherichia coli	A2A0Z2	WP_012817749.1	26120140
SS00037	tccP2	Tir-cytoskeleton coupling protein TccP2 (NCBI)	Escherichia coli	A2A0Z4		26120140
SS00038	tccP2	Tir-cytoskeleton coupling protein TccP2 (NCBI)	Escherichia coli	A2A0Z6		26120140
SS00039		AvrPphF protein (UniProt, NCBI)	Pseudomonas savastanoi	A2BCU8	CAM12736.1	26120140
SS00040		HsvG virulence protein (UniProt, NCBI)	Pantoea agglomerans	A2I8A1	ABM66110.1	16879413
SS00041	hsvB	HsvB type III effector (UniProt, NCBI)	Pantoea agglomerans	A2I8A2	ABM66111.1	16879413
SS00042	bipB	Translocator protein BipB (UniProt)	Burkholderia mallei	A2S1Q0	WP_004533397.1	24391954
SS00043	bipC	Effector protein BipC (UniProt)	Burkholderia mallei	A2S1Q1	WP_004203135.1	25165162
SS00044	bipD	Translocator protein BipD (UniProt)	Burkholderia mallei	A2S1Q3	WP_004188590.1	24391954
SS00045	bopE	Guanine nucleotide exchange factor BopE (UniProt, NCBI)	Burkholderia mallei	A2S1Q7	WP_004188462.1	21106126
SS00046	bopA	Effector protein BopA (UniProt)	Burkholderia mallei	A2S1Q9	WP_004187505.1	21412437
SS00047	bipB	Translocator protein BipB (UniProt)	Burkholderia mallei	A3MCG8	WP_004533397.1
SS00048	bipC	Effector protein BipC (UniProt, NCBI)	Burkholderia mallei	A3MCG9	A2S1Q1.2
SS00049	bipD	Translocator protein BipD (UniProt)	Burkholderia mallei	A3MCH1	WP_004188590.1
SS00050	bopE	Guanine nucleotide exchange factor BopE (UniProt, NCBI)	Burkholderia mallei	A3MCH6	A2S1Q7.1	24391954
SS00051	bopA	Effector protein BopA (UniProt)	Burkholderia mallei	A3MCH8	WP_004187505.1	26120140
SS00052	bopA	Effector protein BopA (UniProt)	Burkholderia pseudomallei	A3NLC6	WP_011853452.1	21106126
SS00053	bopE	Guanine nucleotide exchange factor BopE (UniProt)	Burkholderia pseudomallei	A3NLC8	WP_004528812.1	24391954
SS00054	bipD	Translocator protein BipD (UniProt)	Burkholderia pseudomallei	A3NLD2	WP_004188590.1	25635268
SS00055	bipC	Effector protein BipC (UniProt)	Burkholderia pseudomallei	A3NLD4	WP_028359003.1	27634329
SS00056	bipB	Translocator protein BipB (UniProt)	Burkholderia pseudomallei	A3NLD5	WP_011853456.1	25635268
SS00057	bopA	Effector protein BopA(UniProt)	Burkholderia pseudomallei	A3P6Y8	WP_004536698.1	26120140
SS00058	bopE	Guanine nucleotide exchange factor BopE (UniProt, NCBI)	Burkholderia pseudomallei	A3P6Z0	AGZ30748.1	12897019
SS00059	bipD	Translocator protein BipD (UniProt)	Burkholderia pseudomallei	A3P6Z4	WP_004537374.1
SS00060	bipC	Effector protein BipC (UniProt)	Burkholderia pseudomallei	A3P6Z6	WP_004551891.1
SS00061	bipB	Translocator protein BipB (UniProt)	Burkholderia pseudomallei	A3P6Z7	WP_004537550.1
SS00062	hopI1	HopI1 (UniProt)	Pseudomonas syringae	A3QQZ4		26120140
SS00063	hopI1	hopI1 (UniProt)	Pseudomonas syringae	A3QQZ7		26120140
SS00064	hopI1	hopI1 (UniProt)	Pseudomonas syringae	A3QQZ8	ABD65205.1	26120140
SS00065	hopI1	hopI1 (UniProt)	Pseudomonas syringae	A3QQZ9		26120140
SS00066	hopI1	hopI1 (UniProt, NCBI)	Pseudomonas syringae	A3QR00	ABD65207.1	26120140
SS00067	hopI1	hopI1 (UniProt)	Pseudomonas syringae	A3QR01	PBP71311.1	26120140
SS00068	tccP2	Tir-cytoskeleton coupling protein TccP2 (NCBI)	Escherichia coli	A4PCI6	WP_032165226.1	26120140
SS00069	tccP2	Tir-cytoskeleton coupling protein (UniProt, NCBI)	Escherichia coli	A4PCI7	BAF52035.1	26120140
SS00070	tccP2	Tir-cytoskeleton coupling protein (UniProt, NCBI)	Escherichia coli	A4PDT6	BAF52358.1	26120140
SS00071	tccP2	Tir-cytoskeleton coupling protein (UniProt, NCBI)	Escherichia coli	A4PDT7	BAF52359.1	26120140
SS00072	tccP2	Tir-cytoskeleton coupling protein (UniProt, NCBI)	Escherichia coli	A4PDT8	BAF52360.1	26120140
SS00073	tccP2	Tir-cytoskeleton coupling protein (UniProt, NCBI)	Escherichia coli	A4PDT9	BAF52361.1	26120140
SS00074	tccP2	Tir-cytoskeleton coupling protein TccP2 (NCBI)	Escherichia coli	A4PDU1	WP_052924591.1	26120140
SS00075	tccP2	Tir-cytoskeleton coupling protein (UniProt, NCBI)	Escherichia coli	A4PDU2	BAF52364.1	26120140
SS00076	tccP2	Tir-cytoskeleton coupling protein (UniProt, NCBI)	Escherichia coli	A4PDU3	BAF52365.1	26120140
SS00077	tccP2	Tir-cytoskeleton coupling protein TccP2 (NCBI)	Escherichia coli	A4PDU4	WP_096071309.1	26120140
SS00078	tccP2	Tir-cytoskeleton coupling protein (UniProt, NCBI)	Escherichia coli	A4PDU5	BAF52367.1	26120140
SS00079	tccP2	Tir-cytoskeleton coupling protein TccP2 (NCBI)	Escherichia coli	A4PDU6	WP_096071309.1	26120140
SS00080	tccP2	Tir-cytoskeleton coupling protein TccP2 (NCBI)	Escherichia coli	A4PDU7	WP_000610783.1	26120140
SS00081	tccP2	Tir-cytoskeleton coupling protein (UniProt)	Escherichia coli	A4PDU8	WP_106898774.1	26120140
SS00082	tccP2	Tir-cytoskeleton coupling protein (UniProt, NCBI)	Escherichia coli	A4PDU9	BAF52371.1	26120140
SS00083	tccP2	Tir-cytoskeleton coupling protein TccP2 (NCBI)	Escherichia coli	A4PDV0	WP_061317672.1	26120140
SS00084	tccP2	Tir-cytoskeleton coupling protein TccP2 (NCBI)	Escherichia coli	A4PDV1	WP_061317672.1	26120140
SS00085	tccP2	Tir-cytoskeleton coupling protein (UniProt, NCBI)	Escherichia coli	A4PDV2	BAF52374.1	26120140
SS00086	tccP2	Tir-cytoskeleton coupling protein TccP2 (NCBI)	Escherichia coli	A4PDV3	WP_096071309.1	26120140
SS00087	tccP2	Tir-cytoskeleton coupling protein TccP2 (NCBI)	Escherichia coli	A4PDV5	WP_000610783.1	26120140
SS00088	tir	Translocated intimin receptor Tir (UniProt)	Escherichia coli	A4PHQ3	WP_059215485.1	12410841
SS00089	tir	Translocated intimin receptor Tir (UniProt, NCBI)	Escherichia coli	A4PHQ4	BAF52549.1	26120140
SS00090	ASA_P5G045	T3SS effector inositol phosphatase Ati2 (NCBI)	Aeromonas salmonicida	A4SUE7	WP_011899436.1	24391954
SS00091	aexT	AexT (UniProt, NCBI)	Aeromonas hydrophila	A6YCJ6	ABR13262.1	26120140
SS00092	tir	Translocated intimin receptor Tir (UniProt)	Escherichia coli	A8R3Y1	WP_024231660.1	26120140
SS00093	SARI_01766	type III secretion system effector SifA (NCBI)	Salmonella arizonae	A9MG90	EAA9131191.1	22252866
SS00094	sseL	type III secretion system effector deubiquitinase SseL (NCBI)	Salmonella arizonae	A9MJD1	EAA5368605.1	26120140
SS00095	sseL	SPI-2 type III secretion system effector deubiquitinase SseL (NCBI)	Salmonella enterica	A9N5C6	WP_001017732.1	17158898
SS00096	lcrV	type III secretion system needle tip protein LcrV (NCBI)	Yersinia pestis	A9R9H4	WP_012228705.1	28512097
SS00097	ECO26H__140003	Non-LEE-encoded effector NleH (UniProt)	Escherichia coli	A9ZNE5	AHG07528.1	24391954
SS00098	nleG	Non-LEE-encoded effector NleG (UniProt)	Escherichia coli	A9ZNE9	EJE91668.1	26120140
SS00099	espJ	EspJ family T3SS effector ADP-ribosyltransferase (UniProt)	Escherichia coli	A9ZNF2	WP_001121571.1	24391954
SS00100	nleH	Non-LEE-encoded effector NleH (UniProt)	Escherichia coli	A9ZNF7	AHG07528.1	26120140
SS00101	espJ	Non-LEE-encoded effector EspJ (UniProt)	Escherichia coli	A9ZNG0	WP_001121571.1	26120140
SS00102	nleB	Non-LEE-encoded effector NleB (UniProt)	Escherichia coli	A9ZNG5	WP_000950792.1	16552063
SS00103	nleH	Non-LEE-encoded effector NleH (UniProt)	Escherichia coli	A9ZNG6	EEC7212555.1	26120140
SS00104	nleG	Non-LEE-encoded effector NleG (UniProt)	Escherichia coli	A9ZNG7	EES2576226.1	26120140
SS00105	nleA	Non-LEE-encoded effector NleA (UniProt)	Escherichia coli	A9ZNG8	WP_001102750.1	26120140
SS00106	incD	Inclusion membrane protein IncD (NCBI)	Chlamydia trachomatis	B0B9M3	WP_009873570.1	19390696
SS00107	incE	Inclusion membrane protein IncE (NCBI)	Chlamydia trachomatis	B0B9M4	WP_009873571.1	19390696
SS00108	incF	Inclusion membrane protein IncF(NCBI)	Chlamydia trachomatis	B0B9M5	WP_009873572.1	19390696
SS00109	espM3	EspM3 protein (UniProt)	Citrobacter rodentium	B1GVN9	WP_012907283.1	18331467
SS00110	SbBS512_A0136	OspC3 (UniProt, NCBI)	Shigella boydii	B2TSV7	AAP78984.1	23684308
SS00111	ipaH9.8	E3 ubiquitin-protein ligase ipaH9.8 (UniProt)	Shigella boydii	B2TT54	WP_012421769.1	24391954
SS00112		T3SS secreted effector NleB-homolog (UniProt)	Escherichia coli	B3Y094	WP_000950790.1	26120140
SS00113		T3SS secreted effector NleH-homolog (UniProt)	Escherichia coli	B3Y095	EDX28270.1	26120140
SS00114		T3SS secreted effector NleA-homolog (UniProt)	Escherichia coli	B3Y098	WP_001102750.1	26120140
SS00115		T3SS secreted effector, TccP2 (UniProt)	Escherichia coli	B3Y0A5	WP_048818235.1	26120140
SS00116		T3SS secreted effector NleF-homolog (UniProt)	Escherichia coli	B3Y0U1	EDX27920.1	26120140
SS00117		T3SS secreted effector EspM-homolog (UniProt)	Escherichia coli	B3Y1A0	EHW88736.1	18331467
SS00118		T3SS secreted effector NleE-homolog (UniProt)	Escherichia coli	B3Y1M9	WP_000609744.1	24391954
SS00119	sopA	E3 ubiquitin-protein ligase SopA (UniProt)	Salmonella enterica	B4SX34	WP_000703996.1	24391954
SS00120	sopA	E3 ubiquitin-protein ligase SopA (UniProt)	Salmonella enterica	B4T918	WP_000704000.1
SS00121	sopA	E3 ubiquitin-protein ligase SopA (UniProt)	Salmonella enterica	B4TMK5	WP_000704007.1
SS00122	SeAg_B1559	SPI-2 type III secretion system effector SifB (NCBI)	Salmonella agona	B5F5S8	AKC52824.1	26120140
SS00123	SeAg_B1960	SPI-2 type III secretion system effector SifA (NCBI)	Salmonella agona	B5F8C9	AKC53184.1	26120140
SS00124	sopA	E3 ubiquitin-protein ligase SopA (UniProt)	Salmonella enterica	B5FM34	WP_000703992.1
SS00125	sopA	E3 ubiquitin-protein ligase SopA (UniProt)	Salmonella enterica	B5QZK6	WP_000703991.1
SS00126	SG1233	Type III secretion system, secreted effector protein (SopE) (UniProt)	Salmonella enterica	B5R8S6	WP_000161702.1	24391954
SS00127	E2348C_2916	T3SS secreted effector EspG homolog (UniProt, NCBI)	Escherichia coli	B7UH72	CAS10464.1	26120140
SS00128	E2348C_3230	T3SS secreted effector EspL homolog (UniProt)	Escherichia coli	B7UI20	WP_001121619.1	26120140
SS00129	E2348C_3231	T3SS secreted effector NleB homolog (UniProt)	Escherichia coli	B7UI21	WP_012578998.1	26120140
SS00130	E2348C_3232	T3SS secreted effector NleE homolog (UniProt)	Escherichia coli	B7UI22	WP_000609744.1	26120140
SS00131	E2348C_0718	T3SS secreted effector NleH homolog (UniProt, NCBI)	Escherichia coli	B7ULW4	WP_000950983.1	26120140
SS00132	E2348C_0723	T3SS secreted effector EspJ homolog (UniProt)	Escherichia coli	B7ULW8	WP_001121571.1	26120140
SS00133	E2348C_3930	LEE-encoded effector EspF (UniProt)	Escherichia coli	B7UM88	WP_012579019.1	26120140
SS00134	E2348C_3936	Translocon EspA (UniProt)	Escherichia coli	B7UM94	WP_000381567.1	23437191
SS00135	tir	Translocated intimin receptor Tir (UniProt)	Escherichia coli	B7UM99	WP_001339882.1	26120140
SS00136	map	LEE-encoded effector Map (UniProt, NCBI)	Escherichia coli	B7UMA0	CAS11490.1	26120140
SS00137	espH	LEE-encoded effector EspH (UniProt, NCBI)	Escherichia coli	B7UMA2	SLM08785.1	26120140
SS00138	espG	LEE-encoded effector EspG (UniProt, NCBI)	Escherichia coli	B7UMC8	CAS11518.1	26120140
SS00139	E2348C_0814	hypothetical protein HMPREF9536_05150 (NCBI)	Escherichia coli	B7UMR0	EFJ84609.1	26120140
SS00140	E2348C_1040	T3SS secreted effector NleI/NleG homolog (UniProt)	Escherichia coli	B7UNX2	WP_012578869.1	26120140
SS00141	E2348C_1041	T3SS effector-like protein NleB homolog (UniProt)	Escherichia coli	B7UNX3	WP_000950813.1	26120140
SS00142	E2348C_1042	T3SS secreted effector NleC homolog (UniProt)	Escherichia coli	B7UNX4	WP_000701341.1	26120140
SS00143	E2348C_1044	T3SS secreted effector NleD homolog (UniProt)	Escherichia coli	B7UNX6	WP_001247931.1	26120140
SS00144	E2348C_1442	T3SS secreted effector NleA/EspI homolog (UniProt)	Escherichia coli	B7UR60	EHU16393.1	26120140
SS00145	E2348C_1444	T3SS secreted effector NleH homolog (UniProt)	Escherichia coli	B7UR62	WP_000950979.1	26120140
SS00146	E2348C_1445	T3SS secreted effector NleF homolog (UniProt)	Escherichia coli	B7UR63	WP_000938103.1	26120140
SS00147	map	T3SS effector protein Map (NCBI)	Escherichia coli	B8ZY94	WP_000938103.1	24391954
SS00148	espH	Type III secretion system, translocated effector protein, LEE associated (UniProt, NCBI)	Escherichia coli	B8ZY96	CAX18574.1	24391954
SS00149	sepZ	T3SS secreted effector EspZ (UniProt)	Escherichia coli	B8ZYA3	WP_000386952.1	26120140
SS00150	map	T3SS effector protein Map (NCBI)	Escherichia coli	B8ZYG0	WP_032314772.1	26120140
SS00151	espH	Type III secretion system, translocated effector protein, LEE associated (UniProt, NCBI)	Escherichia coli	B8ZYG2	CAX18649.1	26120140
SS00152	L537_047	type III secretion system protein SepZ (NCBI)	Escherichia coli	B8ZYN7	WP_062893434.1	25561713
SS00153	vopL	putative type III secretion system effector protein VopL (UniProt, NCBI)	Vibrio parahaemolyticus	B9A807	BAH15041.1	17942696
SS00154	vopC	Putative type III secretion system effector protein VopC (UniProt, NCBI)	Vibrio parahaemolyticus	B9A810	BAH15044.1	22787576
SS00155	avrA	RipAA-effector family protein (NCBI)	Ralstonia solanacearum	C0SPP7	WP_172833510.1	27073091
SS00156	popP2	YOPP/AvrRxv family protein (NCBI)	Ralstonia solanacearum	C0SPP9	RAA04514.1	24391954
SS00157	ripT	type III effector protein ript (NCBI)	Ralstonia solanacearum	C0SPQ0	AST85151.1	24391954
SS00158	hpx38	AVRPPHE avirulence protein (UniProt, NCBI)	Ralstonia solanacearum	C0SPQ1	APF85338.1	17427805
SS00160	hpx40	Type III effector HopG1 (UniProt, NCBI)	Ralstonia solanacearum	C0SPQ3	AUS45631.1	19863557
SS00161	hpx43	Hrp-secreted outer protein (UniProt)	Ralstonia solanacearum	C0SPQ6	WP_016723760.1	10922033
SS00162	nopC	Nodulation protein NopC (UniProt, NCBI)	Bradyrhizobium elkanii	C4PL71	BBC02554.1	26569401
SS00163	nopA	Nodulation protein NopA (UniProt, NCBI)	Bradyrhizobium elkanii	C4PL72	WP_075968406.1	23437191
SS00164	nopM	Nodulation protein NopM (NCBI)	Bradyrhizobium elkanii	C4PL85	BBC02569.1	22615567
SS00165		VopF (UniProt, NCBI)	Vibrio cholerae	C5IZN1	ACS27545.1	19779031
SS00166	espF(U)	Secreted effector protein EspF(U) (UniProt)	Escherichia coli	C6UYI3	WP_010917831.1
SS00167	avrE1	AvrE1 (UniProt, NCBI)	Pseudomonas syringae	C8BNV1	ACU65043.1	19445595
SS00168	hopM1	HopM1 (UniProt, NCBI)	Pseudomonas syringae	C8BNW8	ACU65060.1	24324742
SS00169	exoU	ExoU (UniProt, NCBI)	Pseudomonas syringae	C8BNX0	WP_100069506.1	14500525
SS00170	ECO26_1162	Type III effector (UniProt, NCBI)	Escherichia coli	A0A3J9C4M3	WP_012817749.1	26120140
SS00171	ECO9455_03421	T3SS effector EspG (UniProt, NCBI)	Escherichia coli	K4WT30	EIL17425.1	26120140
SS00172	ECO9455_03331	T3SS effector EspZ (UniProt)	Escherichia coli	K4XZX3	CAC81859.1	25561713
SS00173	espH	EspH protein (UniProt)	Escherichia coli	Q9AJ11	AWJ35492.1	22372637
SS00174	ECO9455_03291	T3SS effector Map (UniProt)	Escherichia coli	K4WP32	AWJ35494.1	26120140
SS00175	espF	type III secretion system LEE effector EspF (NCBI)	Escherichia coli	Q9RQE1	WP_001443729.1	26120140
SS00176	espF	type III secretion system LEE effector EspF (NCBI)	Escherichia coli	Q5K5R0	WP_001368749.1	26120140
SS00177	map	T3SS effector protein Map (NCBI)	Escherichia coli	Q5K5P8	AUF78826.1	26120140
SS00178	espH	Secretion protein EspH (UniProt, NCBI)	Escherichia coli	Q5K5P6	EEC7212685.1	26120140
SS00179	espZ	type III secretion system protein SepZ (NCBI)	Escherichia coli	A0A0F3TK69	WP_000338353.1	26120140
SS00180	espG	secretion protein EspG (NCBI)	Escherichia coli	Q5K5M1	ASJ44898.1	26120140
SS00181	nleE	T3SS effector protein NleE (UniProt)	Escherichia coli	A0A023Z7G9	WP_000609742.1	23437191
SS00182	nleB	Type III secretion system effector arginine glycosyltransferase NleB (UniProt, NCBI)	Escherichia coli	A0A6D1F6N9	WP_000953024.1	28860194
SS00183	espG	T3SS secreted effector EspG (UniProt)	Escherichia coli	C8UFJ4	AMF90434.1	26120140
SS00184	espF	T3SS secreted effector EspF (UniProt)	Escherichia coli	C8UFJ7	WP_001369486.1	26120140
SS00185	espH	T3SS secreted effector EspH (UniProt)	Escherichia coli	C8UFL1	AWJ46882.1	26120140
SS00186	espZ	T3SS secreted effector EspZ (UniProt)	Escherichia coli	C8UFL8	WP_000386952.1	26120140
SS00187	ECO111_1081	T3SS secreted effector TccP2 (UniProt)	Escherichia coli	C8UMB1	WP_012817858.1	26120140
SS00188	sopA	E3 ubiquitin-protein ligase SopA (UniProt)	Salmonella enterica	C9X8K0	WP_000703995.1
SS00189	eseD	Type III secretion system effector protein D (UniProt, NCBI)	Edwardsiella tarda	D0ZDK9	ACY83714.1	24391954
SS00190	eseC	Type III secretion system effector protein C (UniProt)	Edwardsiella tarda	D0ZDL0	AGH72966.1	24391954
SS00191	steB	SteB (Reference); Secreted effector protein SteB (UniProt)	Salmonella enterica	D0ZI38	ASE80998.1	16177297
SS00192	steC	Secreted effector kinase SteC (UniProt)	Salmonella enterica	D0ZIB5	WP_001116926.1	23015760
SS00193	sopA	E3 ubiquitin-protein ligase SopA (UniProt)	Salmonella enterica	D0ZMG9	WP_000703998.1	14762020
SS00194	sspH2	E3 ubiquitin-protein ligase SspH2 (UniProt)	Salmonella enterica	D0ZPH9	WP_001115840.1	23935490
SS00195	slrP	E3 ubiquitin-protein ligase SlrP (UniProt)	Salmonella enterica	D0ZRB2	WP_000481997.1	19690162
SS00196	sspH1	E3 ubiquitin-protein ligase SspH1 (UniProt)	Salmonella enterica	D0ZVG2	WP_000481981.1	16611232
SS00197	steA	Secreted effector protein SteA (UniProt)	Salmonella enterica	D0ZXR5	WP_001147134.1	24858684
SS00198	IS481a	Transposase (UniProt, NCBI)	Bordetella pertussis	D1MWR4	BAI59725.1	23437191
SS00199	ospB	OspB, probably secreted by the Mxi-Spa machinery (UniProt)	Shigella flexneri	D2AJ46	WP_001046939.1	19017275
SS00200	ospD2	OspD2, probably secreted by the Mxi-Spa machinery (UniProt,NCBI)	Shigella flexneri	D2AJ54	ADA76735.1	29866849
SS00201	ospD1	OspD1, probably secreted by the Mxi-Spa machinery (UniProt)	Shigella flexneri	D2AJ70	WP_000026470.1	19017268
SS00202	ospD3	OspD3, probably secreted by the Mxi-Spa machinery (UniProt, NCBI)	Shigella flexneri	D2AJE7	ADA76828.1	24391954
SS00203	ipaA	IpaA, secreted by the Mxi-Spa machinery, modulates entry of bacteria into epithelial cells (UniProt)	Shigella flexneri	D2AJI2	WP_005083511.1	24391954
SS00204	ipaH9.8	E3 ubiquitin-protein ligase ipaH9.8 (UniProt)	Shigella flexneri	D2AJU0	WP_000936806.1
SS00205	ospG		Shigella flexneri	D2AJU3	WP_000705601.1	23469023
SS00206	espT	T3SS effector protein EspT (UniProt)	Citrobacter rodentium	D2TI15	WP_012908046.1	21848814
SS00207	espS	T3SS effector protein EspS (UniProt, NCBI)	Citrobacter rodentium	D2TJZ3	CBG87121.1	24391954
SS00208	espI	T3SS effector protein NleA/EspI (UniProt)	Citrobacter rodentium	D2TJZ4	WP_012904700.1	15039354
SS00209	nleC	T3SS effector protein NleC (UniProt)	Citrobacter rodentium	D2TK70	AAS47019.1	25040221
SS00210	nleG1	Putative T3SS effector protein NleG1 (UniProt)	Citrobacter rodentium	D2TK72	WP_012905902.1	27822540
SS00211	espG	T3SS effector protein EspG (UniProt, NCBI)	Citrobacter rodentium	D2TKD5	AAL06389.1	15039354
SS00212	espF		Citrobacter rodentium	D2TKD7	WP_012907101.1	15039354
SS00213	espB	T3SS effector protein EspB (UniProt)	Citrobacter rodentium	D2TKE1	WP_012907105.1	25645555
SS00214	espD	T3SS translocator protein EspD (UniProt)	Citrobacter rodentium	D2TKE2	WP_012907106.1	25645555
SS00215	map	T3SS effector protein Map (UniProt, NCBI)	Citrobacter rodentium	D2TKE9	WP_012907113.1	26120140
SS00216	espH	T3SS effector protein EspH (UniProt, NCBI)	Citrobacter rodentium	D2TKF1	CBG89721.1	15039354
SS00217	espZ	T3SS effector protein EspZ (UniProt, NCBI)	Citrobacter rodentium	D2TKF8	WP_012907122.1	23437191
SS00218	grlA	GrlA, global regulator of LEE activator (UniProt)	Citrobacter rodentium	D2TKG4	WP_012907128.1	24391954
SS00219	grlR	GrlR, global regulator of LEE repressor (UniProt, NCBI)	Citrobacter rodentium	D2TKG5	CBG89736.1	24391954
SS00220	ler	Ler transcriptional regulator (UniProt)	Citrobacter rodentium	D2TKH5	AAL06349.1	24391954
SS00221	nleD-1	T3SS effector protein NleD (UniProt, NCBI)	Citrobacter rodentium	D2TML3	WP_012904922.1	23437191
SS00222	ROD_09131	phage tail assembly protein (NCBI)	Citrobacter rodentium	D2TRA0	WP_012905236.1	24391954
SS00223	nleH	T3SS effector protein NleH (UniProt)	Citrobacter rodentium	D2TRX7	AAS48169.1	23437191
SS00224	nleF	T3SS effector protein NleF (UniProt)	Citrobacter rodentium	D2TRX8	AAS48168.1	23437191
SS00225	espJ	T3SS effector protein EspJ (UniProt)	Citrobacter rodentium	D2TRY1	WP_012908744.1	23437191
SS00226	nleB1	T3SS effector protein NleB1 (UniProt)	Citrobacter rodentium	D2TT37	WP_012905389.1	26120140
SS00227	nleE	T3SS effector protein NleE (UniProt)	Citrobacter rodentium	D2TT38	WP_012905390.1	20485572
SS00228	espX7	Putative T3SS effector protein EspX7 (UniProt)	Citrobacter rodentium	D2TTX7	WP_012905489.1	23437191
SS00229	sipA	Type III secretion effector protein SipA (UniProt, NCBI)	Arsenophonus nasoniae	D2TZ31	CBA72793.1	24391954
SS00230	yopB	Type III secretion effector protein IpaD, SipD, SspD, YopB (UniProt)	Arsenophonus nasoniae	D2TZ32	WP_081700632.1	24391954
SS00231	sipB	Type III secretion effector protein SipB (UniProt)	Arsenophonus nasoniae	D2TZ34	WP_026822347.1	24391954
SS00232	yscW	Type III secreted effector protein YopN,Yop4b,LcrE,InvE (UniProt, NCBI)	Arsenophonus nasoniae	D2TZV2	CBA73375.1	24391954
SS00233	ORFB	Avirulence protein ORFB (UniProt, NCBI)	Erwinia amylovora	D4HVP7	EKV55411.1	20565644
SS00234	dspE	putative avirulence protein DspE (DspA) (UniProt, NCBI)	Erwinia amylovora	D4HVQ0	EKV55414.1	19737101
SS00235	eop2	Type III effector HopAK1 (UniProt, NCBI)	Erwinia amylovora	D4HWC7	WP_004155599.1	24391954
SS00236	HopPtoC	Probable cysteine protease avirulence protein avrPpiC2 (UniProt)	Erwinia amylovora	D4HWL8	WP_004155795.1	24391954
SS00237	avrRpt2	Cysteine protease avirulence protein avrRpt2 (UniProt)	Erwinia amylovora	D4I1J6	CBA23177.1	16776298
SS00238	xopQ	nucleoside hydrolase (NCBI)	Xanthomonas citri	A0A1U8ZCV1	WP_007963549.1	26120140
SS00239	TP45_00795	AvrBs2 type three effector (NCBI)	Xanthomonas citri	A0A2R2WFH5	AEZ54398.1	24391954
SS00240	xopE1	avirulence protein (NCBI)	Xanthomonas citri	D4TBP8	AMU96925.1	23437191
SS00241	xopB	type III secretion XopB family effector (NCBI)	Xanthomonas citri	D4T148	TCK49512.1	23437191
SS00242	xopQ	nucleoside hydrolase (NCBI)	Xanthomonas citri	D4T570	WP_007963549.1	26120140
SS00244	RCFBP_mp20290	Putative type III effector, AWR3 (UniProt, NCBI)	Ralstonia solanacearum	D8P480	WP_013208225.1	26120140
SS00245	RCFBP_mp20473	AWR5 type III effector protein (UniProt, NCBI)	Ralstonia solanacearum	D8P4R3	WP_013208397.1	26120140
SS00246	ripA	Type III effector protein AWR2 (UniProt)	Ralstonia solanacearum	D8P729	YP_003747289.1	26120140
SS00247	sipA	Cell invasion protein SipA (UniProt)	Salmonella enterica	E1WAC6	WP_000258811.1	19390696
SS00248	hopBB1	HopBB1 (UniProt)	Pseudomonas amygdali	E5G0U5	ADQ74896.1	28132837
SS00249	Pgy4_29625	Type III effector AvrRps4 (UniProt, NCBI)	Pseudomonas savastanoi	E7PH30	EFW87133.1	26120140
SS00250	Pgy4_04597	Type III effector HopI1 (UniProt)	Pseudomonas savastanoi	E7PJ45	WP_004655586.1	26120140
SS00251	Pgy4_06407	Type III effector AvrE1 (UniProt)	Pseudomonas savastanoi	E7PKT3	WP_122390119.1	26120140
SS00252	Pgy4_06582	Type III effector HopX1 (UniProt)	Pseudomonas savastanoi	E7PKW2	RMO14137.1	26120140
SS00253	Pgy4_26220	Type III effector HopAU1 (UniProt)	Pseudomonas savastanoi	E7PLP1	RMM85621.1	26120140
SS00254	Pgy4_42589	Type III effector HopH1 (UniProt, NCBI)	Pseudomonas savastanoi	E7PP21	EFW77376.1	26120140
SS00256	ALQ80_02949	Type III effector HopY1 (UniProt, NCBI)	Pseudomonas coronafaciens	A0A3M3D8Y0	RMM33735.1	26120140
SS00257	ALQ48_03573	Type III effector HopAA1-2 (UniProt)	Pseudomonas coronafaciens	A0A3M3SCD9	RMO06323.1	26120140
SS00265	ALP71_00174	Type III effector HopAG1 (UniProt)	Pseudomonas coronafaciens	A0A0P9UWK9	WP_005895613.1	26120140
SS00273	ALQ94_03040	Type III effector HopAG1 (UniProt)	Pseudomonas amygdali	A0A3M2WRQ9	EGH06702.1	26120140
SS00275	ALQ94_02994	Type III effector protein AvrE1 (UniProt)	Pseudomonas amygdali	A0A2S4IJ75	WP_005736337.1	26120140
SS00282	ALQ94_03113	Type III effector HopA1 (NCBI)	Pseudomonas amygdali	A0A2S4I4L1	EGH13275.1	26120140
SS00283	ALQ94_03114	Type III effector HopA1 (UniProt, NCBI)	Pseudomonas amygdali	A0A2S4I4K0	WP_005740288.1	26120140
SS00284	ALQ94_00928	Type III effector HopAU1 (UniProt, NCBI)	Pseudomonas amygdali	A0A3M2WSV6	EGH14446.1	26120140
SS00286	PSYMO_03328	Type III effector HopI1 (UniProt, NCBI)	Pseudomonas amygdali	A0A656G4D5	EGH20568.1	26120140
SS00287	PSYMO_25909	Type III effector HopAB2 (UniProt, NCBI)	Pseudomonas amygdali	A0A656GG29	EGH24698.1	26120140
SS00288	PSYMO_38638	hypothetical protein PSYMO_38638 (NCBI)	Pseudomonas amygdali	A0A656GNA3	EGH27097.1	26120140
SS00289	PSYJA_02014	Type III effector HopI1 (UniProt)	Pseudomonas syringae	F3FCB6		26120140
SS00290	PSYJA_03539	Type III effector HopAA1 (UniProt, NCBI)	Pseudomonas syringae	F3FD33	EGH28119.1	26120140
SS00291	PSYJA_03564	Type III effector protein AvrE1 (Unipro, NCBI)	Pseudomonas syringae	F3FD38	EGH28124.1	26120140
SS00292	PSYJA_03719	Type III effector HopZ3 (UniProt, NCBI)	Pseudomonas syringae	F3FD65	EGH28151.1	26120140
SS00293	PSYPI_00155	Type III effector HopA1 (UniProt)	Pseudomonas syringae	F3G1H5		19525323
SS00294	PSYPI_01205	Type III effector HopX1 (UniProt)	Pseudomonas syringae	F3G207	EGH41107.1	26120140
SS00295	PSYPI_01212	Type III effector HopX1 (UniProt)	Pseudomonas syringae	F3G208	EGH41108.1	26120140
SS00296	PSYPI_01402	Type III effector protein AvrE1 (UniProt, NCBI)	Pseudomonas syringae	F3G242	EGH41142.1	26120140
SS00297	PSYPI_01432	Type III effector HopAA1 (UniProt, NCBI)	Pseudomonas syringae	F3G248	EGH41148.1	26120140
SS00298	PSYPI_05543	Type III effector HopI1 (UniProt)	Pseudomonas syringae	F3G4A3	WP_003340856.1	26120140
SS00299	PSYPI_21055	Type III effector HopH1 (UniProt, NCBI)	Pseudomonas syringae	F3GCB9	WP_003345750.1	26120140
SS00300	PSYPI_25434	Type III effector HopAG1 (UniProt)	Pseudomonas syringae	F3GEH5	WP_003347056.1	26120140
SS00301	PSYPI_26319	Type III effector AvrRps4 (UniProt, NCBI)	Pseudomonas syringae	F3GEX7		26120140
SS00302	B1F71_01040	HopA1 (UniProt)	Pseudomonas syringae	A0A1H1MQF9	ALE00933.1	26120140
SS00303	PSYCIT7_05440	Type III effector protein AvrE1 (UniProt, NCBI)	Pseudomonas syringae	A0A656GSU4	EGH51103.1	26120140
SS00304	PSYCIT7_05470	Type III effector HopAA1 (UniProt, NCBI)	Pseudomonas syringae	A0A656GSX5	EGH51109.1	26120140
SS00305	PSYCIT7_23615	Type III effector HopAG1 (UniProt, NCBI)	Pseudomonas syringae	A0A656H0U7	EGH54560.1	26120140
SS00306	PSYCIT7_30927	Type III effector HopI1 (UniProt)	Pseudomonas syringae	A0A656H641	EGH55913.1	26120140
SS00307	PSYCIT7_31346	Type III effector HopI1 (UniProt)	Pseudomonas syringae	A0A656H5T7	EGH55986.1	26120140
SS00308	PSYCIT7_31811	Type III effector HopI1 (UniProt)	Pseudomonas syringae	A0A656H7M6	EGH56078.1	26120140
SS00309	PSYCIT7_32870	Type III effector HopI1 (UniProt)	Pseudomonas syringae	A0A656H7U2	EGH56289.1	26120140
SS00311	PMA4326_02677	Type III effector AvrE1 (UniProt)	Pseudomonas syringae	A0A0N0FKK8	WP_007248467.1	26120140
SS00320	AC507_3920	Type III effector HopO1-1 (UniProt, NCBI)	Pseudomonas syringae	A0A0N0FBJ7	KPB71124.1	26120140
SS00322	PLA106_02720	Type III effector HopI1 (UniProt, NCBI)	Pseudomonas amygdali	F3ICX9	AAO58206.1	26120140
SS00323	PLA106_03887	Type III effector HopF2 (UniProt, NCBI)	Pseudomonas amygdali	F3IDL2	EGH95106.1	26120140
SS00324	PLA106_04187	Type III effector protein AvrE1 (UniProt, NCBI)	Pseudomonas amygdali	F3IDS2	EGH95178.1	26120140
SS00325	PLA106_04212	Type III effector HopAA1-1 (UniProt, NCBI)	Pseudomonas amygdali	F3IDS7	EGH95183.1	26120140
SS00326	PLA106_10666	Type III effector HopAB2 (UniProt, NCBI)	Pseudomonas amygdali	F3IHD9	EGH96534.1	26120140
SS00327	PLA106_13794	Type III effector HopA1 (UniProt, NCBI)	Pseudomonas amygdali	F3IJ53	EGH97169.1	26120140
SS00328	PLA106_14206	Type III effector HopAH2-1 (UniProt)	Pseudomonas amygdali	F3IJD5	WP_005767312.1	26120140
SS00329	PLA106_14211	Type III effector HopAH2-2 (UniProt)	Pseudomonas amygdali	F3IJD6		26120140
SS00330	PLA106_21293	Type III effector HopY1 (UniProt, NCBI)	Pseudomonas amygdali	F3INB8	AAO53615.1	26120140
SS00331	PLA106_22398	Type III effector HopAG1 (UniProt)	Pseudomonas amygdali	F3INY7	EGH98853.1	26120140
SS00332	PLA106_22443	Type III effector HopAG1 (UniProt)	Pseudomonas amygdali	F3INZ6	EGH98862.1	26120140
SS00333	PLA106_22878		Pseudomonas amygdali	F3IP81	EGH98947.1	26120140
SS00334	PLA106_22883	Type III effector HopO1-3 (UniProt, NCBI)	Pseudomonas amygdali	F3IP82	EGH98948.1	26120140
SS00335	PLA106_22888	Type III effector HopO1-2 (UniProt, NCBI)	Pseudomonas amygdali	F3IP83	EGH98949.1	26120140
SS00336	PLA106_27176	Type III effector HopS2 (UniProt, NCBI)	Pseudomonas amygdali	F3IRM5	EGH99791.1	26120140
SS00337	PLA106_27186	Type III effector HopO1-2 (UniProt, NCBI)	Pseudomonas amygdali	F3IRM7	WP_005771670.1	26120140
SS00341	ALO35_01977	Type III effector HopI1 (UniProt)	Pseudomonas amygdali	A0A0N1JIP6	WP_005745414.1	26120140
SS00345	ALP03_03173	Type III effector HopT1-1 (UniProt, NCBI)	Pseudomonas amygdali	A0A3M6G7Q0	RMV88885.1	26120140
SS00349	hopAA1-1	Type III effector HopAA1-1 (UniProt, NCBI)	Pseudomonas syringae	G3XDB9	KPY91178.1	26120140
SS00350	xopQ	Type III effector protein XopQ (UniProt, NCBI)	Xanthomonas oryzae	G7TIR4	AEQ94357.1	26120140
SS00351	hopAU1	Type III effector HopAU1 (UniProt, NCBIt)	Pseudomonas syringae	G9I6Y2	AEV42014.1	26120140
SS00352		outer protein D (UniProt, NCBI)	Xanthomonas campestris	G9L9K6	AEU04524.1	26120140
SS00353	xopQ	Type III effector protein (UniProt)	Xanthomonas arboricola	H2BNU5	AEX33790.1	26120140
SS00354	xopQ	Type III effector protein (UniProt)	Xanthomonas arboricola	H2BNU9	AEX33794.1	26120140
SS00355	xopQ	Type III effector protein (UniProt)	Xanthomonas campestris	H2BNV7	AEX33794.1	26120140
SS00356	xopQ	Type III effector protein (UniProt)	Xanthomonas axonopodis	H2EMV1	AEX58663.1	26120140
SS00357	xopR	T3SS effector protein XopR (NCBI)	Xanthomonas oryzae	H6UWS2	AFV08855.1	26120140
SS00358	H9L407	type III secretion systems effector SseF (NCBI)	Salmonella enterica	H9L407	WP_000690718.1	26120140
SS00359	sseE	pathogenicity island 2 effector protein SseE (NCBI)	Salmonella enterica	H9L446	WP_151253718.1	26120140
SS00360	spvB		Salmonella enterica	H9L477	YP_003864189.1	26120140
SS00361	sseG	pathogenicity island 2 effector protein SseG (NCBI)	Salmonella enterica	H9L486	WP_000805851.1	26120140
SS00362	hopAB3	AvrPtoB type III effector (UniProt)	Pseudomonas syringae	I1V8A5	AFI33127.1	26120140
SS00363	hopAB3	AvrPtoB type III effector (UniProt)	Pseudomonas syringae	I1V8A6	AFI33128.1	26120140
SS00364	hopAB3	AvrPtoB type III effector (UniProt)	Pseudomonas syringae	I1V8A7	AFI33129.1	26120140
SS00365	hopAB3	AvrPtoB type III effector (UniProt)	Pseudomonas syringae	I1V8A8	AFI33130.1	26120140
SS00366	hopAB2	AvrPtoB type III effector (UniProt)	Pseudomonas syringae	I1V8A9	AFI33131.1	26120140
SS00367	hopAB2	AvrPtoB type III effector (UniProt)	Pseudomonas syringae	I1V8B0	AFI33132.1	26120140
SS00368	hopA1	Type III effector HopA1 (UniProt)	Pseudomonas syringae	J7I9B3	AFQ35552.1	26120140
SS00369	hopA1	Type III effector HopA1 (UniProt)	Pseudomonas syringae	J7I9B7	AFQ35557.1	26120140
SS00370	avrE1	Avirulence E1 effector (UniProt)	Pseudomonas syringae	J7I9E2	AFQ35566.1	26120140
SS00371	avrE1	Avirulence E1 effector (UniProt)	Pseudomonas syringae	J7I9R7	AFQ35566.1	26120140
SS00372	hopA1	Type III effector HopA1 (UniProt)	Pseudomonas syringae	J7I9V0	AFQ35555.1	26120140
SS00373	hopA1	Type III effector HopA1 (UniProt)	Pseudomonas syringae	J7I9V5	AFQ35559.1	26120140
SS00374	avrE1	Avirulence E1 effector (UniProt)	Pseudomonas syringae	J7I9W3	AFQ35570.1	26120140
SS00375	avrE1	Avirulence E1 effector (UniProt)	Pseudomonas syringae	J7I9W8	AFQ35571.1	26120140
SS00376	avrE1	Type III effector avirulence E1 (UniProt)	Pseudomonas syringae	J7IA88	AFQ35566.1	26120140
SS00377	hopA1	Type III effector HopA1 (UniProt)	Pseudomonas syringae	J7IDH5	AFQ35554.1	26120140
SS00378	avrE1	Type III effector avirulence E1 (UniProt)	Pseudomonas syringae	J7IDX1	AFQ35669.1	26120140
SS00379	hopA1	Type III effector HopA1 (UniProt)	Pseudomonas syringae	J7IE52	AFQ35759.1	26120140
SS00380	hopA1	Type III effector HopA1 (UniProt)	Pseudomonas syringae	J7IG74	AFQ35553.1	26120140
SS00381	hopA1	Type III effector HopA1 (UniProt)	Pseudomonas syringae	J7IG80	AFQ35558.1	26120140
SS00382	avrE1	Type III effector avirulence E1 (UniProt)	Pseudomonas syringae	J7IGK1	AFQ35566.1	26120140
SS00383	hopA1	Type III effector HopA1 (UniProt)	Pseudomonas syringae	J7IGZ7	AFQ35556.1	26120140
SS00384	avrE1	Type III effector avirulence E1 (UniProt)	Pseudomonas syringae	J7IHF0	AFQ35671.1	26120140
SS00385	avrE1	Type III effector avirulence E1 (UniProt)	Pseudomonas syringae	J7IHF5	AFQ35667.1	26120140
SS00386	hopA1	Type III effector HopA1 (UniProt)	Pseudomonas syringae	J7IHN8	AFQ35551.1	26120140
SS00387	CT143	hypothetical protein CT_143 (NCBI)	Chlamydia trachomatis	K0GGG6	NP_219646.1	26120140
SS00388	ALP32_02711	Type III effector HopAH2-2 (UniProt, NCBI)	Pseudomonas avellanae	A0A3M5TYK5	RMU38423.1	26120140
SS00391	ALP32_200160	type III effector HopBB1 (NCBI)	Pseudomonas avellanae	A0A3M5TKI9	EKG29764.1	26120140
SS00395	ALP32_04208	Type III effector HopH1 (UniProt, NCBI)	Pseudomonas avellanae	A0A3M5T0Y0	RMU27201.1	26120140
SS00396	ALP32_200347	type III effector AvrRps4 (NCBI)	Pseudomonas avellanae	A0A3M5TXA8	EKG29747.1	26120140
SS00397	ALQ98_04712	Type III effector HopX1 (UniProt, NCBI)	Pseudomonas syringae	A0A0P9SS82	KPX63893.1	26120140
SS00398	Pav631_4276	HopO1-3 (UniProt)	Pseudomonas avellanae	A0A3M5TK21	WP_005620561.1	26120140
SS00400	ALO75_01002	Type III effector HopAI1 (UniProt, NCBI)	Pseudomonas syringae	A0A0P9NJA0	RMR81635.1	26120140
SS00401	ALQ98_00963	Type III effector HopAA1 (UniProt, NCBI)	Pseudomonas syringae	A0A3M2UBF8	RML20861.1	26120140
SS00403	ALP32_04288	Type III effector HopY1 (UniProt, NCBI)	Pseudomonas avellanae	A0A3M5STQ8	WP_005613222.1	26120140
SS00404	CXB37_16030	Type III effector HopBF1 (UniProt, NCBI)	Pseudomonas syringae	A0A2S4J8L5	ALU58326.1	26120140
SS00405	sopE	Guanine nucleotide exchange factor SopE (UniProt)	Salmonella dublin	O06949		26120140
SS00406	popB	PopB (UniProt, NCBI)	Pseudomonas aeruginosa	O30529	AAC45937.1	24391954
SS00407	IncC	Inclusion membrane protein C (UniProt, NCBI)	Chlamydia caviae	O30783	AAC46379.1	19390696
SS00408	sopB	Inositol phosphate phosphatase SopB (UniProt)	Salmonella enterica	O30916	WP_001166946.1	23437191
SS00410	copN	CopN protein (UniProt)	Chlamydia caviae	O34020	WP_011006420.1	19390696
SS00411	sopB	Inositol phosphate phosphatase SopB (UniProt)	Salmonella dublin	O34105	O34105.1	21106126
SS00412	exoU	ExoU (Reference, UniProt)	Pseudomonas aeruginosa	O34208	WP_003134060.1	14500525;24391954
SS00413	sopE	Guanine nucleotide exchange factor SopE (UniProt)	Salmonella typhimurium	O52623	WP_000161707.1	19390696
SS00414	yopT	Cysteine protease YopT (UniProt, NCBI)	Yersinia pestis	O68703	YP_004210032.1	21106126
SS00415	incA	Inclusion membrane protein A (UniProt, NCBI)	Chlamydia trachomatis	P0DPS5	P0DPS5.1	24391954
SS00416	CT_053	hypothetical protein CT_053 (NCBI)	Chlamydia trachomatis	O84056		26120140
SS00417	CT_083	hypothetical protein CT_083 (NCBI)	Chlamydia trachomatis	O84085	NP_219586.1	24391954
SS00418	CT_105	hypothetical protein CT_105 (NCBI)	Chlamydia trachomatis	O84107	NP_219608.1	26120140
SS00419	incE	IncE (UniProt)	Chlamydia trachomatis	B7SCF5	WP_009873571.1	24391954
SS00420	incF	IncF (UniProt)	Chlamydia trachomatis	B7SCF6	WP_010725072.1	24391954
SS00421	incG	Inclusion membrane protein G (UniProt, NCBI)	Chlamydia trachomatis	P0DPS6	WP_009871465.1	24391954
SS00422	CT_142	hypothetical protein CT_142 (NCBI)	Chlamydia trachomatis	O84144	NP_219645.1	26120140
SS00423	CT_161	hypothetical protein CT_161 (NCBI)	Chlamydia trachomatis	O84163	NP_219664.1	26120140
SS00424	CT_223	IncA family protein (NCBI)	Chlamydia trachomatis	O84226	WP_010725128.1	24391954
SS00425	CT_229	hypothetical protein G11222_01175 (NCBI)	Chlamydia trachomatis	O84232	ADH18839.1	24391954
SS00426	incB	Inclusion Membrane Protein B (UniProt)	Chlamydia trachomatis	O84235	WP_009871579.1	19390696
SS00427	incC	Inclusion Membrane Protein C (UniProt, NCBI)	Chlamydia trachomatis	O84236	WP_009871580.1	19390696
SS00428	CT_288	hypothetical protein CT_288 (NCBI)	Chlamydia trachomatis	O84290	NP_219793.1	24391954
SS00429	CT_338	hypothetical protein CT_338 (NCBI)	Chlamydia trachomatis	O84342	NP_219845.1	26120140
SS00430	aaxB	Pyruvoyl-dependent arginine decarboxylase AaxB (UniProt, NCBI)	Chlamydia trachomatis	O84378	WP_010725175.1	24391954
SS00431	CT_429	UPF0158 protein CT_429 (UniProt)	Chlamydia trachomatis	O84436	NP_219941.1	26120140
SS00432	srp	Sulfur-rich protein, serovar D (UniProt)	Chlamydia trachomatis	O84449	NP_219954.1	24391954
SS00433	tarP	type III secretion system actin-recruiting effector Tarp (NCBI)	Chlamydia trachomatis	O84462	WP_010725202.1	19390696
SS00434	CT_529	hypothetical protein CT_529 (NCBI)	Chlamydia trachomatis	O84534	NP_220044.1	24391954
SS00435	CT_550	hypothetical protein CT_550 (NCBI)	Chlamydia trachomatis	O84554	NP_220065.1	24391954
SS00436	CT_610	Probable oxidoreductase CT_610 (NCBI)	Chlamydia trachomatis	O84616	O84616.1	24391954
SS00437	CT_618	hypothetical protein CT_618 (NCBI)	Chlamydia trachomatis	O84623	NP_220135.1	24391954
SS00438	CT_620	hypothetical protein CT_620 (NCBI)	Chlamydia trachomatis	O84625	NP_220137.1	26120140
SS00439	CT_621	hypothetical protein CT_621 (NCBI)	Chlamydia trachomatis	O84626	NP_220138.1	23437191
SS00440	CT_642	hypothetical protein CT_642 (NCBI)	Chlamydia trachomatis	O84648	NP_220160.1	24391954
SS00441	CT_694	hypothetical protein CT_694 (NCBI)	Chlamydia trachomatis	O84700	NP_220213.1	23437191
SS00442	CT_712	Hypothetical protein CTDEC_0712 (NCBI)	Chlamydia trachomatis	O84718	ADI51389.1	24391954
SS00443	CT_718		Chlamydia trachomatis	O84723		24391954
SS00444	yycJ	ribonuclease Z (NCBI)	Chlamydia trachomatis	O84743	CCP48136.1	24391954
SS00445	CT_847	hypothetical protein CT_847 (NCBI)	Chlamydia trachomatis	O84854	NP_220368.1	24391954
SS00446	CT_848	hypothetical protein CT_848 (NCBI)	Chlamydia trachomatis	O84855	NP_220369.1	24391954
SS00447	CT_849	hypothetical protein CT_849 (NCBI)	Chlamydia trachomatis	O84856	NP_220370.1	26120140
SS00448	CT_861	type III secretion system translocon subunit CopB2 (NCBI)	Chlamydia trachomatis	O84869	WP_010725374.1	23437191
SS00449	CT_863	hypothetical protein CT_863 (NCBI)	Chlamydia trachomatis	O84871	NP_220385.1	24391954
SS00450	CT_875	hypothetical protein CT_875 (NCBI)	Chlamydia trachomatis	O84883	NP_219502.1	26120140
SS00451	sseA	Type III secretion system chaperone SseA (UniProt)	Salmonella enterica	O84944	WP_001738219.1	23437191
SS00452	sseC	Secreted effector protein SseC (UniProt)	Salmonella enterica	O84947	WP_001079760.1	23437191
SS00453	sseE	Pathogenicity island 2 effector protein SseE (UniProt)	Salmonella enterica	O84949	WP_000249606.1	24391954
SS00454	sseF	Pathogenicity island 2 effector protein SseF (UniProt, NCBI)	Salmonella enterica	O84951	NP_460369.1	23437191
SS00455	sseG	Pathogenicity island 2 effector protein SseG (UniProt, NCBI)	Salmonella enterica	O84952	AGK08283.1	23437191
SS00456	hrcQb	Type III secretion protein HrcQb (UniProt, NCBI)	Pseudomonas savastanoi	O85094	WP_004666088.1
SS00457	yopO	Protein kinase YopO (UniProt, NCBI)	Yersinia enterocolitica	O85239	NP_052380.1	19390696
SS00458	exoY	type III secretion system adenylate cyclase effector ExoY (NCBI)	Pseudomonas aeruginosa	O85345	WP_016263503.1	19680249
SS00459	espG	EspG (UniProt)	Escherichia coli	O85646	ASE48005.1	19390696
SS00460	pthG	PthG (UniProt, NCBI)	Pantoea agglomerans	O85666	AAC24862.2	24391954
SS00461	hrpW	type III effector HrpK (NCBI)	Pseudomonas syringae	O87327	KTB81138.1	24391954
SS00462	hrpZ	Harpin HrpZ (UniProt, NCBI)	Pseudomonas syringae	O87653	O87653.1	24391954
SS00463	yopE	Outer membrane virulence protein YopE (UniProt)	Pseudomonas fluorescens	P08008	WP_002229754.1	26120140
SS00464	yopH	Tyrosine-protein phosphatase YopH (UniProt)	Yersinia pseudotuberculosis serotype I	P08538	WP_002213278.1	23437191
SS00465	spaN	Surface presentation of antigens protein SpaN (UniProt)	Shigella flexneri	P0A1K5	NP_858284.1	23437191
SS00466	spvC	type III secretion system effector phosphothreonine lyase SpvC (NCBI)	Salmonella enterica	P0A2M9	WP_001122242.1	24391954
SS00467	map	Methionine aminopeptidase (UniProt)	Escherichia coli	P0AE20	WP_001018194.1	24391954
SS00468	yopT1	Cysteine protease yopT1 (UniProt)	Yersinia enterocolitica	P0C2N1	WP_005176719.1	19390696
SS00469	yscX	Yop proteins translocation protein X (UniProt)	Yersinia enterocolitica	P0C2N4	WP_002212969.1
SS00470	sspH2	E3 ubiquitin-protein ligase sspH2 (UniProt)	Salmonella enterica	P0CE12	WP_001115840.1	19390696
SS00471	incA	Inclusion membrane protein A (UniProt)	Chlamydia trachomatis	P0CI27
SS00472	sipC	Cell invasion protein SipC (UniProt)	Salmonella enterica	P0CL47	WP_000909019.1	23437191
SS00473	sipA	Cell invasion protein SipA (UniProt)	Salmonella enterica	P0CL52	WP_000258811.1	19390696
SS00474	spiC	Salmonella pathogenicity island 2 protein C (UniProt)	Salmonella enterica	P0CZ04	WP_001738217.1	26120140
SS00475	espF(U)	Secreted effector protein EspF(U) (UniProt)	Escherichia coli	P0DJ88	WP_010917831.1	19390696
SS00476	espF(U)	Secreted effector protein EspF(U) (UniProt)	Escherichia coli	P0DJ89	WP_010917831.1	19390696
SS00477	incD	inclusion membrane protein IncD (NCBI)	Chlamydia trachomatis	P0DJI3	WP_009871462.1	19390696
SS00478	incE	inclusion membrane protein IncE (NCBI)	Chlamydia trachomatis	P0DJI4	WP_010725071.1	19390696
SS00479	incF	inclusion membrane protein IncF (NCBI)	Chlamydia trachomatis	P0DJI5	WP_010725072.1	19390696
SS00480	avrA	Avirulence protein A (UniProt, NCBI)	Pseudomonas savastanoi	P11437	P11437.1	19390696
SS00481	avrB	Avirulence protein B (UniProt, NCBI)	Pseudomonas savastanoi	P13835	P13835.1	19390696
SS00482	avrBs3	Avirulence protein AvrBs3 (UniProt)	Xanthomonas euvesicatoria	P14727	P14727.2	24391954
SS00483	yopH	Tyrosine-protein phosphatase YopH (UniProt)	Yersinia enterocolitica	P15273	WP_010891234.1	26120140
SS00484	yopM	Outer membrane protein YopM (UniProt)	Yersinia pestis	P17778	WP_002229779.1	26120140
SS00485	ipaH4.5	Probable E3 ubiquitin-protein ligase ipaH4.5 (UniProt)	Shigella flexneri	P18009	WP_010921638.1	26120140
SS00486	ipaA	Invasin IpaA (UniProt, NCBI)	Shigella flexneri	P18010	EGK22689.1	23437191
SS00487	ipaB	Invasin IpaB (UniProt)	Shigella flexneri	P18011	WP_010921663.1	23437191
SS00488	ipaC	Invasin IpaC (UniProt)	Shigella flexneri	P18012	WP_031942475.1	23437191
SS00489	ipaD	Invasin IpaD (UniProt)	Shigella flexneri	P18013	WP_010921661.1	23437191
SS00490	ipaH7.8	Probable E3 ubiquitin-protein ligase ipaH7.8 (UniProt)	Shigella flexneri	P18014	WP_010921637.1	26120140
SS00491		Uncharacterized 12.2 kDa protein in lcrE 5'region (UniProt, NCBI)	Yersinia enterocolitica	P21211	P21211.1
SS00492	yopQ	Protein YopQ (UniProt, NCBI)	Yersinia enterocolitica	P27474	P27474.1	23437191
SS00493	yopT	Cysteine protease YopT (UniProt)	Yersinia enterocolitica	P27475	WP_010891203.1	19390696
SS00494	sodA	Superoxide dismutase [Mn] (UniProt)	Listeria monocytogenes	P28764	WP_003721944.1	24391954
SS00495	yopE	Outer membrane virulence protein YopE (UniProt)	Yersinia enterocolitica	P31492	WP_010891237.1	26120140
SS00496	yopE	Outer membrane virulence protein YopE (UniProt, NCBI)	Yersinia pestis	P31493	YP_004210019.1	23437191
SS00497	yopJ	Effector protein YopJ (UniProt)	Pseudomonas fluorescens	P31498	WP_002225474.1	26120140
SS00498	nolB	Nodulation protein NolB (UniProt, NCBI)	Rhizobium fredii	P33208	WP_014857557.1	23437191
SS00499	icsB	Virulence protein IcsB (UniProt)	Shigella flexneri	P33546	WP_010921665.1	24391954
SS00500	ipgB	Protein IpgB (UniProt)	Shigella flexneri	P33548	ADA76868.1	24391954
SS00501	hrpZ	Harpin HrpZ (UniProt, NCBI)	Pseudomonas syringae	P35674	WP_003433477.1
SS00502	yopB	Protein YopB (UniProt)	Yersinia enterocolitica	P37131	WP_010891208.1	24391954
SS00503	yopD	Protein YopD (UniProt)	Yersinia enterocolitica	P37132	WP_010891207.1	24391954
SS00504	yscQ	Yop proteins translocation protein Q (UniProt)	Pseudomonas fluorescens	P40296	WP_054105001.1
SS00505	spaN	Surface presentation of antigens protein SpaN (UniProt, NCBI)	Salmonella enterica	P40613	P40613.1	19390696
SS00506	spaO	Surface presentation of antigens protein SpaO (UniProt)	Salmonella enterica	P40699	EAN3830061.1
SS00507	sopD	Secreted effector protein SopD (UniProt)	Salmonella enterica	P40722	KMJ26268.1	19390696
SS00508	yscQ	Yop proteins translocation protein Q (UniProt)	Yersinia pestis	P42713	WP_054105001.1
SS00509	NGR_a03640	NopM (Reference); Probable E3 ubiquitin-protein ligase NGR_a03640 (UniProt)	Rhizobium fredii	P55456	AAB91674.1	22615567
SS00510	NGR_a02610	type III secretion system YopJ family effector NopJ (NCBI)	Rhizobium fredii	P55555	WP_010875286.1	24391954
SS00511	nopL	Nodulation outer protein L (UniProt)	Rhizobium fredii	P55704		23437191
SS00512	nopX	Nodulation outer protein X (UniProt)	Rhizobium fredii	P55711	WP_010875111.1	23437191
SS00513	nolB	Nodulation protein NolB (UniProt, NCBI)	Rhizobium fredii	P55713	WP_010875109.1	26120140
SS00514	nopP	NopP (Reference); Effector protein NopP (UniProt)	Rhizobium fredii	P55724	WP_010875098.1	15231809;24391954
SS00515	NGR_a00490	Putative cysteine protease YopT-like y4zC (UniProt)	Rhizobium fredii	P55730	WP_010875091.1	24391954
SS00516	yscH	Yop proteins translocation protein H (UniProt)	Yersinia pestis	P68590	NP_857725.1	26120140
SS00517	yscM	Yop proteins translocation protein M (UniProt)	Yersinia pestis	P69978	WP_002212907.1	24391954
SS00518	sipA	Cell invasion protein SipA (UniProt)	Salmonella enterica	P74849	WP_000258814.1	24391954
SS00519	sptP	Secreted effector protein SptP (UniProt)	Salmonella enterica	P74851	WP_000946989.1	24391954
SS00520	spiC	Salmonella pathogenicity island 2 protein C (UniProt)	Salmonella enterica	A0A0W4EPV0	NP_460358.1	24391954
SS00521	sptP	Secreted effector protein SptP (UniProt)	Salmonella enterica	P74873	WP_000922300.1	19390696
SS00522	yopM	Yop effector YopM (UniProt, NCBI)	Yersinia enterocolitica	P74988	NP_052388.1	26120140
SS00523	hrpN	Harpin HrpN (UniProt)	Erwinia amylovora	Q01099	WP_004155369.1	24391954
SS00524	mxiC	Protein MxiC (UniProt)	Shigella flexneri	Q04640	WP_010921674.1	23437191
SS00525	eaeB	Protein EaeB (UniProt)	Escherichia coli	Q05129	WP_001091991.1	26120140
SS00526	ypkA	Protein kinase YpkA (UniProt)	Pseudomonas fluorescens	Q05608		19390696
SS00527	avrBs4	Avirulence protein avrBs4 (UniProt, NCBI)	Xanthomonas vesicatoria	Q07061	CAA48680.1	23437191
SS00528	ipgD	Inositol phosphate phosphatase IpgD (UniProt)	Shigella flexneri	Q07566	YP_009062490.1	23437191
SS00529	avrP	Chain A, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto (NCBI)	Pseudomonas syringae	Q08242	2QKW_A	24391954
SS00530	hrmA	Protein HrmA (UniProt, NCBI)	Pseudomonas syringae	Q08370	Q08370.1	19390696
SS00531	avrRxv	Avirulence protein AvrRxv (UniProt)	Xanthomonas euvesicatoria	Q08678	WP_011346137.1	23437191
SS00532	popC	PopC (UniProt, NCBI)	Xanthomonas oryzae	Q156B7	ABG23671.1	26120140
SS00533	exoU	type III secretion system effector cytotoxin ExoU (NCBI)	Pseudomonas aeruginosa	Q1W4Y8	WP_023098783.1	26120140
SS00534	aopO	Salmonella pathogenicity island 2 protein C (UniProt)	Aeromonas salmonicida	Q27RI0	WP_005321178.1	26120140
SS00535	aopH	AopH (UniProt)	Aeromonas salmonicida	Q27RI1	WP_011899483.1	26120140
SS00536		HrpY (UniProt, NCBI)	Acidovorax avenae	Q2AC60	BAE80275.1	26120140
SS00537	ospF	Phosphothreonine lyase OspF (UniProt, NCBI)	Shigella dysenteriae	Q2ET08	Q2ET08.1	26120140
SS00538	ospF	Phosphothreonine lyase OspF (UniProt, NCBI)	Shigella boydii	Q2ET28	Q2ET08.1	26120140
SS00539	tccP	Tir-cytoskeleton coupling protein (UniProt. NCBI)	Escherichia coli	Q2F7Y9	ABB16333.1	26120140
SS00540	tir	Translocated intimin receptor (UniProt)	Escherichia coli	Q2F7Z0	WP_024223567.1	26120140
SS00541	sipB	Cell invasion protein SipB (NCBI)	Sodalis glossinidius	Q2NVH6	AAS66851.1	24391954
SS00542	hopAB3	Effector protein HopAB3 (UniProt)	Pseudomonas syringae	Q2QCI9	Q2QCI9.1	24391954
SS00543	STM2137	Putative cytoplasmic protein (UniProt)	Salmonella enterica	Q2QHF9	AAZ76144.1	26120140
SS00544	bopA	Effector protein BopA (UniProt)	Burkholderia thailandensis	Q2T703	WP_011401050.1	21106126
SS00545	bopE	Guanine nucleotide exchange factor BopE (UniProt, NCBI)	Burkholderia thailandensis	Q2T704	WP_009896161.1	21106126
SS00546	bipD	Translocator protein BipD (UniProt)	Burkholderia thailandensis	Q2T708	WP_025404166.1
SS00547	bipC	Effector protein BipC (UniProt)	Burkholderia thailandensis	Q2T710	WP_009896151.1	26120140
SS00548	bipB	Translocator protein BipB (UniProt)	Burkholderia thailandensis	Q2T711	WP_011401047.1
SS00549	ipaH9.8	E3 ubiquitin-protein ligase ipaH9.8 (UniProt)	Shigella boydii	Q31SH3	WP_000936800.1
SS00550	ospF	Phosphothreonine lyase OspF (UniProt, NCBI)	Shigella boydii	Q31SR9	Q31SR9.1	26120140
SS00551	virA	Cysteine protease-like VirA (UniProt)	Shigella dysenteriae	Q326N4	AHA69218.1	24391954
SS00552	ipgB1	IpgB1 (UniProt)	Shigella dysenteriae	Q326S7	WP_001166524.1	23437191
SS00553	ipaJ	IpaJ (UniProt)	Shigella dysenteriae	Q326T5	SPZ80070.1	23437191
SS00554	ipaH9.8	E3 ubiquitin-protein ligase ipaH9.8 (UniProt)	Shigella dysenteriae	Q326Z6	WP_000936809.1
SS00555	ospC1	OspC1 (UniProt)	Shigella dysenteriae	Q327E0	WP_011379035.1	23437191
SS00556	ospF	Phosphothreonine lyase OspF (UniProt, NCBI)	Shigella dysenteriae	Q327I2	Q327I2.1	26120140
SS00557	ospB	OspB (UniProt, NCBI)	Shigella dysenteriae	Q327J1	WP_011379054.1	23437191
SS00558	xopQ	Xanthomonas outer protein Q (UniProt)	Xanthomonas campestris	Q3BM44	AAV74206.1	24391954
SS00559	xopN	Xanthomonas outer protein N (UniProt)	Xanthomonas campestris	Q3BRD8	AAV74202.1	24391954
SS00560	xopF2	Xanthomonas outer protein F2 (UniProt)	Xanthomonas campestris	Q3BRE0	CAJ24621.1	24391954
SS00561	xopC	Xanthomonas outer protein C (UniProt)	Xanthomonas campestris	Q3BSU7	AAR23832.1	24391954
SS00562	xopJ	Xanthomonas outer protein J (UniProt)	Xanthomonas campestris	Q3BTM6	WP_011347382.1	24391954
SS00563	xopP	Xanthomonas outer protein P (UniProt)	Xanthomonas campestris	Q3BW96	AAV74208.1	24391954
SS00564	xopO	Xanthomonas outer protein O (UniProt, NCBI)	Xanthomonas campestris	Q3BWS7	WP_011346566.1	24391954
SS00565	xopB	Xanthomonas outer protein B (UniProt, NCBI)	Xanthomonas campestris	Q3BY51	CAJ22212.1	24391954
SS00566	xopX	Xanthomonas outer protein X (UniProt)	Xanthomonas campestris	Q3BY60	AOY68224.1	24391954
SS00567	avrRxv	Avirulence protein AvrRxv (UniProt)	Xanthomonas campestris	Q3BYG1	WP_011346137.1	24391954
SS00568	xopD	Xanthomonas outer protein D (UniProt)	Xanthomonas campestris	Q3BYJ5	CAJ22068.1	24391954
SS00569	xopF1	Xanthomonas outer protein F1 (UniProt)	Xanthomonas campestris	Q3BYL8	WP_011346095.1	24391954
SS00570	avrBs1	Avirulence protein AvrBs1 (UniProt)	Xanthomonas campestris	Q3C000	CAJ19916.1	23437191
SS00571	bipB	Translocator protein BipB (UniProt)	Burkholderia pseudomallei	Q3JL23	WP_004528817.1
SS00572	bipC	Effector protein BipC (UniProt)	Burkholderia pseudomallei	Q3JL24	WP_004528816.1	21106126
SS00573	bipD	Translocator protein BipD (UniProt)	Burkholderia pseudomallei	Q3JL26	WP_004188590.1
SS00574	bopE	Guanine nucleotide exchange factor BopE (UniProt, NCBI)	Burkholderia pseudomallei	Q3JL30	WP_004528812.1	21106126
SS00575	bopA	Effector protein BopA (UniProt)	Burkholderia pseudomallei	Q3JL32	WP_004528810.1	26120140
SS00576	ipaH9.8	E3 ubiquitin-protein ligase ipaH9.8 (UniProt)	Shigella sonnei	Q3YTH5	WP_000936807.1
SS00577	virA	Cysteine protease-like VirA (UniProt, NCBI)	Shigella sonnei	Q3YTK0	Q3YTK0.1	21106126
SS00578	mxiL	MxiL (UniProt, NCBI)	Shigella sonnei	Q3YTN8	AAZ91124.1	23437191
SS00579	ospF	Phosphothreonine lyase OspF (UniProt)	Shigella sonnei	Q3YTY3	AAZ91029.1	26120140
SS00580	incA	inclusion membrane protein A (NCBI)	Chlamydia caviae	Q46210	AAP05293.1	19390696
SS00581	espA	EspA (UniProt)	Escherichia coli	Q47184	WP_000381567.1	25645555
SS00582	hrpN	Harpin HrpN (UniProt)	Dickeya chrysanthemi	Q47278	WP_040001177.1	24391954
SS00583	hopAB1	Effector protein hopAB1 (UniProt, NCBI)	Pseudomonas savastanoi	Q48B61	Q48B61.1	19390696
SS00584	avrD1	Syringolide biosynthetic protein AvrD1 (UniProt, NCBI)	Pseudomonas savastanoi	Q48B68	AAZ37987.1	23437191
SS00585	avrRps4	Type III effector AvrRps4 (UniProt, NCBI)	Pseudomonas savastanoi	Q48B92	AAZ38042.1	26120140
SS00586	hopAU1	Type III effector HopAU1 (UniProt, NCBI)	Pseudomonas savastanoi	Q48BC6	AAX12110.1	26120140
SS00587	hopD1	Type III effector HopD1 (UniProt)	Pseudomonas savastanoi	Q48BE0	WP_011282444.1	19390696
SS00588	hopI1	Type III effector HopI1 (UniProt, NCBI)	Pseudomonas savastanoi	Q48DQ9	AAZ33342.1	26120140
SS00589	hopAE1	Effector protein hopAE1 (UniProt, NCBI)	Pseudomonas savastanoi	Q48DU8	Q48DU8.1	24391954
SS00590	hopX1	Type III effector HopX1 (UniProt, NCBI)	Pseudomonas savastanoi	Q48M17	AAZ37209.1	26120140
SS00591	avrE1	Type III effector AvrE1 (UniProt, NCBI)	Pseudomonas savastanoi	Q48M45	AAZ34169.1	26120140
SS00592	eseD	Type III secretion system effector protein D (UniProt)	Edwardsiella tarda	Q4ACE6	BAE19884.1	26120140
SS00593	eseB	EseB (UniProt, NCBI)	Edwardsiella tarda	Q4G4C8	ADM40935.1	24391954
SS00594	eseC	EseC (UniProt, NCBI)	Edwardsiella tarda	Q4G4D0	AAV69404.1	23437191
SS00595	eseD	EseD (UniProt, NCBI)	Edwardsiella tarda	Q4G4D1	AAV69405.1	26120140
SS00596	hopAB1	Effector protein hopAB1 (UniProt, NCBI)	Pseudomonas syringae	Q4ZMD6	WP_011269154.1	26120140
SS00597	Psyr_4326	Type III effector HopI1 (UniProt, NCBI)	Pseudomonas syringae	Q4ZNB6	RMR49188.1	26120140
SS00598	Psyr_1889	Type III effector HopH1 (UniProt, NCBI)	Pseudomonas syringae	Q4ZV89	AAY36933.1	26120140
SS00599	Psyr_1224	Type III effector HopZ3 (UniProt)	Pseudomonas syringae	Q4ZX47	WP_011266899.1	26120140
SS00600	Psyr_1220	Type III effector HopX1 (UniProt, NCBI)	Pseudomonas syringae	Q4ZX48	AAY36274.1	26120140
SS00601	Psyr_1188	Type III effector protein AvrE1 (UniProt, NCBI)	Pseudomonas syringae	Q4ZX80	AAY36242.1	26120140
SS00602	hopM1	Effector protein hopM1 (UniProt, NCBI)	Pseudomonas syringae	Q4ZX82	PYD11074.1	24391954
SS00603	Psyr_1183	Type III effector HopAA1 (UniProt, NCBI)	Pseudomonas syringae	Q4ZX85	AAY36237.1	26120140
SS00604	Psyr_1017	Type III effector HopJ1 (UniProt, NCBI)	Pseudomonas syringae	Q4ZXP9	AAY36073.1	24391954
SS00605	Psyr_0738	Type III effector protein AvrRpm1 (UniProt, NCBI)	Pseudomonas syringae	Q4ZYH0	WP_011266597.1	23437191
SS00606	nopP	NopP (UniProt, NCBI)	Rhizobium fredii	Q50EL2	AAY33495.1	23437191
SS00607	exoS	Exoenzyme S (UniProt, NCBI)	Pseudomonas aeruginosa	Q51451	CAA67834.1	19680249
SS00608		Uncharacterized protein (UniProt)	Pseudomonas syringae	Q52389	AAC43431.1	19390696
SS00609	avrPphE	AvrPphE (UniProt, NCBI)	Pseudomonas savastanoi	Q52394	KPB61822.1	19390696
SS00611	avrPph3	Cysteine protease avirulence protein AvrPphB (UniProt, NCBI)	Pseudomonas savastanoi	Q52430	Q52430.1	24391954
SS00612	avrRps4	Avirulence protein (UniProt)	Pseudomonas syringae	Q52432	AAB51082.1	19390696
SS00614	hrpA	Hrp pili protein HrpA (UniProt, NCBI)	Pseudomonas savastanoi	Q52480	Q52480.1
SS00615	hrpZ	HrpZ (Reference); Harpin HrpZ (UniProt)	Pseudomonas savastanoi	Q52481	RMN11121.1	11953310
SS00616	hrpC	HrpC protein (UniProt, NCBI)	Ralstonia solanacearum	Q52497	CAB58259.1	24391954
SS00617	avrD	Avirulence gene D (UniProt)	Pseudomonas savastanoi	Q52530	AAA20579.2	19390696
SS00618	avrPmaA1	AvrPmaA1 protein (UniProt)	Pseudomonas syringae	Q52537	CAA48009.1	24391954
SS00619	ipgD	Inositol phosphate phosphatase IpgD (UniProt, NCBI)	Shigella sonnei	Q55286	EJL18802.1	21106126
SS00620	sipB	Cell invasion protein SipB (UniProt)	Salmonella enterica	Q56019	EAM2495865.1	26120140
SS00621	sipC	SPI-1 type III secretion system needle tip complex protein SipC (UniProt, NCBI)	Salmonella enterica	A0A059QAM0	WP_000909019.1	24391954
SS00622	sipD	Cell invasion protein SipD (UniProt)	Salmonella enterica	Q56026	EAX9274794.1	24391954
SS00623	sipA	SPI-1 type III secretion system effector SipA (UniProt)	Salmonella enterica	A0A0W4JE17	E1WAC6.1	21106126
SS00624	sifA	Secreted effector protein SifA (UniProt)	Salmonella enterica	Q56061	WP_094889292.1	19390696
SS00625	sipB	Cell invasion protein SipB (UniProt)	Salmonella enterica	Q56134	AKD16728.1	24391954
SS00626	sipC	Cell invasion protein SipC (UniProt)	Salmonella enterica	Q56135	WP_000909023.1	21106126
SS00627	ypkA	Protein kinase A (UniProt)	Yersinia enterocolitica	Q56921		19390696
SS00628	yopK	YopK (UniProt)	Yersinia pseudotuberculosis	Q56935		19390696
SS00629	pipB2	Secreted effector protein PipB2 (UniProt)	Salmonella enterica	Q57KZ6	WP_001540738.1	24391954
SS00630	sseL	Deubiquitinase SseL (UniProt)	Salmonella enterica	Q57M66	WP_011264333.1	26120140
SS00631	sopA	E3 ubiquitin-protein ligase SopA (UniProt)	Salmonella enterica	Q57MS9	Q57MS9.2
SS00632	sifB	Translocated effector SifB (UniProt, NCBI)	Salmonella enterica	Q57P56	AAX65505.1	26120140
SS00633	sseE	Secretion system effector SseE (UniProt)	Salmonella enterica	Q57PN2	WP_000249606.1	23437191
SS00634	ssaB	Secretion system apparatus SsaB (UniProt)	Salmonella enterica	Q57PP1	AKW02830.2	23437191
SS00635	sopB	SPI-1 type III secretion system effector inositol phosphate phosphatase SopB (NCBI)	Salmonella enterica	Q57QR2	AJQ69097.1	19390696
SS00636	tir	type III secretion system LEE translocated intimin receptor Tir (NCBI)	Escherichia coli	Q58I88	WP_024240337.1	19390696
SS00637		Type III effector HopAU1 (UniProt, NCBI)	Pseudomonas savastanoi	Q5DI80	AAX12110.1	26120140
SS00638	ecf	Early chlorosis factor protein (UniProt, NCBI)	Xanthomonas euvesicatoria	Q5EN61	AAW88576.1	23437191
SS00639	sptP	Secreted effector protein SptP (UniProt)	Salmonella enterica	Q5PEA9	WP_000946993.1	26120140
SS00640	pipB2	Secreted effector protein PipB2 (UniProt)	Salmonella enterica	Q5PEX4	WP_011233153.1	26120140
SS00641	sopE	Guanine nucleotide exchange factor SopE (UniProt)	Salmonella enterica	Q5PFI5	WP_000161709.1	26120140
SS00642	sopE2	Guanine nucleotide exchange factor sopE2 (UniProt)	Salmonella enterica	Q5PHN0	WP_001284212.1	21106126
SS00643	sseL	Deubiquitinase SseL (UniProt)	Salmonella enterica	Q5PI48	WP_001017746.1	26120140
SS00644	xopP	XopP (UniProt)	Xanthomonas euvesicatoria	Q5QA86	CAJ22867.1	23437191
SS00645	xopQ	XopQ (UniProt, NCBI)	Xanthomonas euvesicatoria	Q5QA88	AAV74206.1	26120140
SS00646	xopF2	XopF2 (UniProt)	Xanthomonas euvesicatoria	Q5QA89	CAJ24621.1	23437191
SS00647	xopN	XopN (UniProt, NCBI)	Xanthomonas euvesicatoria	Q5QA92	AAV74202.1	23437191
SS00648	XopF1	hypothetical protein BHE83_17005 (NCBI)	Xanthomonas euvesicatoria	Q5RJF5	AOY68086.1	23437191
SS00649	aopB	AopB (UniProt, NCBI)	Aeromonas hydrophila	Q5XL02	AAV30235.1	26120140
SS00650	nleE	NleE (UniProt)	Citrobacter rodentium	Q5XMK7	WP_012905390.1	26120140
SS00651	nopX	Nodulation protein (UniProt, NCBI)	Rhizobium fredii	Q5Y4S2	AAU85363.1	26120140
SS00652	hrcQb	Type III secretion protein HrcQb (UniProt, NCBI)	Pseudomonas syringae	Q60235	Q60235.1
SS00653	hrpW	Harpin secretion protein HrpW (UniProt, NCBI)	Pseudomonas syringae	Q60236	Q60236.1	24391954
SS00654	bipB	Translocator protein BipB (UniProt, NCBI)	Burkholderia mallei	Q62B07	A2S1Q0.1
SS00655	bipC	Effector protein BipC (UniProt)	Burkholderia mallei	Q62B08	WP_004203135.1
SS00656	bipD	Translocator protein BipD (UniProt, NCBI)	Burkholderia mallei	Q62B10	A2S1Q3.1
SS00657	bopE	Guanine nucleotide exchange factor BopE (UniProt, NCBI)	Burkholderia mallei	Q62B14	A2S1Q7.1	21106126
SS00658	bopA	Effector protein BopA (UniProt)	Burkholderia mallei	Q62B16	WP_004187505.1	26120140
SS00659	bipB	Translocator protein BipB (UniProt, NCBI)	Burkholderia pseudomallei	Q63K34	A2S1Q0.1	23437191
SS00660	bipC	Effector protein BipC (UniProt)	Burkholderia pseudomallei	Q63K35	WP_004203135.1	23437191
SS00662	BPSS1528	type 3 secretion system effector BapA (NCBI)	Burkholderia pseudomallei	Q63K38	WP_011205636.1	24391954
SS00663	bapC	type 3 secretion system effector BapC (NCBI)	Burkholderia pseudomallei	Q63K40	WP_004188424.1	24391954
SS00664	bopE	Guanine nucleotide exchange factor BopE (UniProt, NCBI)	Burkholderia pseudomallei	Q63K41	A3NLC8.1	23437191
SS00665	bopA	Effector protein BopA (UniProt)	Burkholderia pseudomallei	Q63K42	WP_004528810.1
SS00666	BPSS1516	Uncharacterized protein (UniProt)	Burkholderia pseudomallei	Q63K50		26120140
SS00667	yscH	Yop proteins translocation protein H (UniProt)	Pseudomonas fluorescens	Q663I2	WP_011191390.1	19390696
SS00668	pYV0047	YopM putative targeted effector protein (UniProt)	Pseudomonas fluorescens	Q663L9	WP_011191377.1	19390696
SS00669	rip19	TAL effector protein Rip19 (UniProt)	Ralstonia solanacearum	Q68A49	AOE93173.1
SS00670	aopB	AopB (UniProt, NCBI)	Aeromonas hydrophila	Q699Q8	AAS91821.1	26120140
SS00671	xopX	Effector protein (UniProt)	Xanthomonas euvesicatoria	Q6IV70	AOY68224.1	23437191
SS00672	hopW1-2	Putative truncated effector protein hopW1-2 (UniProt, NCBI)	Pseudomonas syringae	Q6J2E6	Q6J2E6.1	26120140
SS00673	avrRpt2	Cysteine protease avirulence protein AvrRpt2 (UniProt, NCBI)	Pseudomonas syringae	Q6LAD6	WP_081012136.1	24391954
SS00674	vopJ	type III secretion system YopJ family effector VopA (NCBI)	Vibrio parahaemolyticus	Q6PLD0	WP_015313492.1	24391954
SS00675	nleF	Non-LEE-encoded type III effector F (UniProt)	Citrobacter rodentium	Q6Q513	CBG91573.1	24391954
SS00676	yspA	YspA (UniProt, NCBI)	Sodalis glossinidius	Q6R8C3	AAS66853.1	24391954
SS00677	yspB	YspB (UniProt, NCBI)	Sodalis glossinidius	Q6R8C5	AAS66851.1	26120140
SS00678	dspE	DspE (UniProt)	Pectobacterium atrosepticum	Q6RK53		24391954
SS00679	aopB	AopB (UniProt)	Aeromonas hydrophila	Q6TLM0	WP_043123807.1	24391954
SS00680	xopC	Type III effector XopC (UniProt)	Xanthomonas euvesicatoria	Q6TQF0	CAJ24112.1	23437191
SS00681	ALP25_03258	Orf34 (UniProt)	Pseudomonas syringae	Q6VE93	WP_011152901.1	24391954
SS00683	ipaH1.4	IpaH1.4 (UniProt, NCBI)	Shigella flexneri	Q6XVT8	AAP79042.1	23437191
SS00684	popP1	PopP1 protein (UniProt, NCBI)	Ralstonia solanacearum	Q700V9	CAF32331.1	24391954
SS00685	popP1	Avirulence protein AvrRxv (UniProt)	Ralstonia solanacearum	Q700W1	WP_051048318.1	26120140
SS00686	sipB	Cell invasion protein SipB (UniProt)	Salmonella enterica	Q79BT1		26120140
SS00687	hopD2	Effector protein hopD2 (UniProt, NCBI)	Pseudomonas syringae	Q79LY0	KPY25151.1	24391954
SS00688	bll8201	Bll1862 protein (UniProt)	Bradyrhizobium diazoefficiens	Q79UN8	AND87458.1	24391954
SS00689	sopE	Guanine nucleotide exchange factor SopE (UniProt)	Salmonella enterica	Q7BD17	WP_000161708.1	26120140
SS00690	avrRpm1	avrPmaA1 (NCBI)	Pseudomonas syringae	Q7BE94	CAA48009.1	19390696
SS00691	ospD3	OspD3 (SenA), probably secreted by the Mxi-Spa secretion machinery, function unknown (NCBI)	Shigella flexneri	Q7BEN0	YP_009062471.1	26120140
SS00692	avrE	AvrE (UniProt, NCBI)	Pseudomonas syringae	Q7BM43	AAF71499.1	26120140
SS00693	nopB	nodulation protein NolB (NCBI)	Rhizobium fredii	Q7BMF3	WP_014857557.1	26120140
SS00694	yopE	Yop effector YopE (UniProt)	Yersinia enterocolitica	Q7BRY7	CBY78144.1	19390696
SS00695	yopH	Yop effector YopH (UniProt)	Yersinia enterocolitica	Q7BRY8	WP_010891234.1	19390696
SS00696	yscH	Secreted protein YopR (UniProt)	Yersinia enterocolitica	Q7BRZ4	Q01249.1	19390696
SS00697	yopQ	YopQ (UniProt, NCBI)	Yersinia enterocolitica	Q7BS06	NP_052384.1	19390696
SS00698	virA	Cysteine protease-like VirA (UniProt)	Shigella flexneri	Q7BU69	YP_009062518.1	23437191
SS00699	sseB	Secreted effector protein SseB (UniProt)	Salmonella enterica	Q7BVH7		23437191
SS00700	sopE2	Guanine nucleotide exchange factor sopE2 (UniProt)	Salmonella enterica	Q7CQD4		19390696
SS00701	espD	EspD (UniProt)	Escherichia coli	Q7DB81	EEC7222169.1	9080609
SS00702	espF	EspF (UniProt)	Escherichia coli	Q7DB85	WP_000931693.1	19390696
SS00703	plu4750	Uncharacterized protein (UniProt)	Photorhabdus luminescens	Q7MYD1	CAE17122.1	23437191
SS00704	plu2515	hypothetical protein AA106_04990 (NCBI)	Photorhabdus luminescens	Q7N439	KTL62881.1	24391954
SS00705	sseE	Secretion system effector SseE (UniProt)	Chromobacterium violaceum	Q7NUX3	SUX35772.1	24391954
SS00706	spvC	Hydrophilic protein, virA protein (UniProt)	Chromobacterium violaceum	Q7NYG6	WP_011134862.1	26120140
SS00707	CV_0296	Toxin sopE2 (NCBI)	Chromobacterium violaceum	Q7P1B7	SUX40438.1	24391954
SS00708	Psyr_0527	Putative type III effector HolPtoACPsy (UniProt)	Pseudomonas syringae	Q7PC42	AAY35597.1	19390696
SS00709	Psyr_0778	Putative type III effector HolPsyAG (UniProt)	Pseudomonas syringae	Q7PC45	AAY35836.2	19390696
SS00710	hopAE1	Effector protein hopAE1 (UniProt, NCBI)	Pseudomonas syringae	Q7PC62	WP_011268930.1	19390696
SS00711	bopB	Putative outer protein B (UniProt)	Bordetella pertussis	Q7VWI4	WP_010930824.1	23437191
SS00712	cif	type III secretion system effector Cif (NCBI)	Escherichia coli	Q7WRZ5	EFA4278516.1	24391954
SS00713	CCA_00170	type III secretion system actin-recruiting effector Tarp (NCBI)	Chlamydophila caviae	Q824H6	WP_011006142.1	19390696
SS00714	ipaH3	E3 ubiquitin-protein ligase ipaH3 (UniProt)	Shigella flexneri	Q83RJ4	WP_011069360.1	26120140
SS00715	hpaG	HpaG (UniProt)	Xanthomonas axonopodis	Q83XF9	ABK51582.1	26120140
SS00716	hopA1	HopA1 (UniProt)	Pseudomonas syringae	Q83YM3		26120140
SS00717	hopX1	AvrPphE (UniProt)	Pseudomonas amygdali	Q83YM6	RMV93069.1	26120140
SS00718	ALO72_02855	Uncharacterized protein (UniProt)	Pseudomonas syringae	Q83YN7		26120140
SS00719	avrE	AvrE (UniProt)	Pseudomonas syringae	Q840G7	AAP31245.1	26120140
SS00720	CYO81_08295	type III secreted protein BopD (NCBI)	Bordetella pertussis	Q84CS5	ETH08364.1	26120140
SS00721	bopN	BopN protein (UniProt)	Bordetella pertussis	Q84CS9	AIW92506.1	23437191
SS00722	yopP	type III secretion system YopJ family effector YopP (NCBI)	Yersinia enterocolitica	Q84GR3	WP_005176633.1	23437191
SS00723	yopM	Yop effector YopM (UniProt)	Yersinia enterocolitica	Q84GT9	WP_011100754.1	11575934
SS00724	VPA1370	type III secretion system effector VopL (NCBI)	Vibrio parahaemolyticus	Q87GE5	WP_005491021.1	24391954
SS00725	VPA1357	hypothetical protein D025_1473 (NCBI)	Vibrio parahaemolyticus	Q87GF9	EQM46419.1	26120140
SS00726	VPA1327	T3SS effector ADP-ribosyltransferase toxin VopT (NCBI)	Vibrio parahaemolyticus	Q87GI9	NES63684.1	24391954
SS00727	vopS	Adenosine monophosphate-protein transferase VopS (UniProt)	Vibrio parahaemolyticus	Q87P32	Q87P32.1	23437191
SS00728	VP1683	type III secretion system effector VopR (NCBI)	Vibrio parahaemolyticus	Q87P35	WP_005464656.1	24391954
SS00729	VP1680	type III secretion system effector VopQ (NCBI)	Vibrio parahaemolyticus	Q87P38	WP_005464333.1	23437191
SS00730	PSPTO_5354	Type III effector HopA1 (UniProt)	Pseudomonas syringae	Q87UE5	WP_011105440.1	26120140
SS00731	PSPTO_5061	HopAN1 protein (UniProt)	Pseudomonas syringae	Q87V79	AAO58488.1	19390696
SS00732	hopI1	Type III effector HopI1 (UniProt)	Pseudomonas syringae	Q87W07	WP_005763320.1	19390696
SS00733	hopG1	Type III effector HopG1 (UniProt)	Pseudomonas syringae	Q87W42	AAO53316.1	19390696
SS00734	hopV1	Type III effector HopV1 (UniProt, NCBI)	Pseudomonas syringae	Q87W46	AAO58158.1	19390696
SS00735	hopAA1-2	Type III effector HopAA1-2 (UniProt)	Pseudomonas syringae	Q87W48	AAO33453.1	26120140
SS00736	hopAD1	Effector protein hopAD1 (UniProt, NCBI)	Pseudomonas syringae	Q87W65	WP_011105124.1	19390696
SS00737	hopS1	Type III effector HopS1 (UniProt, NCBI)	Pseudomonas syringae	Q87WF4	AAO58043.1	24391954
SS00738	hopO1-2	Type III effector HopO1-2 (UniProt, NCBI)	Pseudomonas syringae	Q87WF6	AAO58040.1	26120140
SS00739	hopO1-2	Type III effector HopT1-2 (UniProt, NCBI)	Pseudomonas syringae	Q87WF7	AAO58039.1	19390696
SS00740	hopO1-3	Type III effector HopO1-3 (UniProt, NCBI)	Pseudomonas syringae	Q87WF8	WP_011105071.1	26120140
SS00741	hopS2	Type III effector HopS2 (UniProt, NCBI)	Pseudomonas syringae	Q87WG2	AAO58034.1	26120140
SS00742	hopE1	Type III effector HopE1 (UniProt)	Pseudomonas syringae	Q87X57	AAO53317.1	19390696
SS00743	hopAK1	Type III helper protein HopAK1 (UniProt, NCBI)	Pseudomonas syringae	Q87XS5	WP_011104876.1	19390696
SS00744	hopAH2-2	Type III effector HopAH2-2 (UniProt, NCBI)	Pseudomonas syringae	Q87ZX9	AAO56771.1	26120140
SS00745	hopAH2-1	Type III effector HopAH2-1 (UniProt)	Pseudomonas syringae	Q87ZY0	WP_011104480.1	26120140
SS00746	PSPTO_2872	HopL1 protein (UniProt, NCBI)	Pseudomonas syringae	Q881L7	AAO56368.1	19390696
SS00747	hopP1	Type III helper protein HopP1 (UniProt, NCBI)	Pseudomonas syringae	Q882F0	AAO56180.1	19390696
SS00748	hopAF1	Type III effector HopAF1 (UniProt)	Pseudomonas syringae	Q886L1		19390696
SS00749	hrcQa	Type III secretion protein hrcQa (UniProt, NCBI)	Pseudomonas syringae	Q887B7	WP_011103535.1
SS00750	avrE1	Type III effector protein AvrE1 (UniProt, NCBI)	Pseudomonas syringae	Q887C9	AAO54899.1	23437191
SS00751	hopM1	Effector protein HopM1 (UniProt, NCBI)	Pseudomonas syringae	Q887D0	WP_005763919.1	19390696
SS00752	hopAI1	Type III effector HopAI1 (UniProt, NCBI)	Pseudomonas syringae	Q888W0	AAO54440.1	19390696
SS00753	hopAG1	Type III effector HopAG1 (UniProt, NCBI)	Pseudomonas syringae	Q888W3	AAO54435.1	23437191
SS00754	hopR1	Type III effector HopR1 (UniProt, NCBI)	Pseudomonas syringae	Q888Y1	AAO54417.1	19390696
SS00755	hopQ1-1	Type III effector HopQ1-1 (UniProt, NCBI)	Pseudomonas syringae	Q888Y7	AAO54411.1	19390696
SS00756	hopD1	Effector protein hopD1 (UniProt, NCBI)	Pseudomonas syringae	Q888Y8	WP_011103324.1	23437191
SS00757	hopAJ1	Type III helper protein HopAJ1 (UniProt, NCBI)	Pseudomonas syringae	Q889A9	AAO54387.1	19390696
SS00758	hopH1	Type III effector HopH1 (UniProt, NCBI)	Pseudomonas syringae	Q88A09	AAO54130.1	19390696
SS00759	hopF2	type III effector HopF2 (NCBI)	Pseudomonas syringae	Q88A90	AAO54046.1	26120140
SS00760	hopAS1	Type III effector HopAS1 (UniProt, NCBI)	Pseudomonas syringae	Q88AB8	AAO54018.1	19390696
SS00761	hopY1	Type III effector HopY1 (UniProt, NCBI)	Pseudomonas syringae	Q88BF6	AAO53615.1	19390696
SS00762	hopT1-1	Type III effector HopT1-1 (UniProt)	Pseudomonas syringae	Q88BP7	AAO59044.1	26120140
SS00763	hopO1-1	Type III effector HopO1-1 (UniProt)	Pseudomonas syringae	Q88BP8	AAO59043.1	26120140
SS00764	HopX1	Type III effector HopX1 (UniProt)	Pseudomonas syringae	Q88BQ2		23437191
SS00765	bll8244	Bll8244 protein (UniProt)	Bradyrhizobium diazoefficiens	Q89BB8	AND93063.1	23437191
SS00766	nodN	Nodulation protein N (UniProt)	Bradyrhizobium diazoefficiens	Q89N83	AWO90898.1	26120140
SS00767	blr1904	Blr1904 protein (UniProt)	Bradyrhizobium diazoefficiens	Q89TL5	AND87489.1	23437191
SS00768	nolB	type III effector NopB (NCBI)	Bradyrhizobium diazoefficiens	Q89TP9	AGH09934.1	26120140
SS00769	blr1693	Blr1693 protein (UniProt)	Bradyrhizobium diazoefficiens	Q89TT5	AND87313.1	24391954
SS00770	blr1656	Blr1656 protein (UniProt)	Bradyrhizobium diazoefficiens	Q89TW7	AGH09984.1	23437191
SS00771	blr1649	Blr1649 protein (UniProt)	Bradyrhizobium diazoefficiens	Q89TX4	WP_011084464.1	24391954
SS00772	xopD	Xanthomonas outer protein D (NCBI)	Xanthomonas euvesicatoria	Q8RJQ0	CAJ22068.1	23437191
SS00773	avrPphDPgy	Effector protein AvrPphDPgy (UniProt, NCBI)	Pseudomonas savastanoi	Q8RK06	Q8RK06.1	21106126
SS00774	avrPphDPsv	Effector protein AvrPphDPsv (UniProt, NCBI)	Pseudomonas savastanoi	Q8RK07	PAB34947.1	21106126
SS00775	hopAB1	Effector protein hopAB1 (UniProt)	Pseudomonas savastanoi	Q8RK09	CAD29302.1	21106126
SS00776	hopAB1	Effector protein hopAB1 (UniProt)	Pseudomonas savastanoi	Q8RK12	Q8RK12.1	21106126
SS00777		Type III effector AvrEPma (UniProt)	Pseudomonas syringae	Q8RNY8	AAL84254.1	26120140
SS00778		Type III effector HopPtoA1Pma (UniProt, NCBI)	Pseudomonas syringae	Q8RP03	AAL84253.1	19390696
SS00779	hopAB3	Effector protein hopAB3 (UniProt)	Pseudomonas syringae	Q8RP04	AAL84252.1	26120140
SS00780		Type III effector HopI1 (UniProt)	Pseudomonas syringae	Q8RP09		26120140
SS00781	hopZ1	HopZ1 (UniProt)	Pseudomonas syringae	Q8RP13	AAL84243.1	26120140
SS00782	hopW1-1	Effector protein hopW1-1 (UniProt)	Pseudomonas syringae	Q8RP17	YP_025680.1	26120140
SS00783	hopAB2	Effector protein HopAB2 (UniProt)	Pseudomonas syringae	Q8RSY1	AAL71883.1	26120140
SS00784	ropE	Putative type III secreted protein (UniProt, NCBI)	Pseudomonas fluorescens	Q8VPK4	AAK74145.1	24391954
SS00785	sopE	Guanine nucleotide exchange factor SopE (UniProt)	Salmonella enterica	Q8VPM1	WP_000161703.1	26120140
SS00786	sipA	Cell invasion protein SipA (UniProt)	Salmonella enterica	Q8VQB5	WP_000258819.1	26120140
SS00787	ipaH9.8	E3 ubiquitin-protein ligase ipaH9.8 (UniProt)	Shigella flexneri	Q8VSC3	WP_011114775.1
SS00788	ospF	Phosphothreonine lyase OspF (UniProt)	Shigella flexneri	Q8VSP9		26120140
SS00789	sopE	Guanine nucleotide exchange factor SopE (UniProt)	Salmonella enterica	Q8VSQ6	WP_000161702.1	26120140
SS00790	sopE	Guanine nucleotide exchange factor SopE (UniProt)	Salmonella enterica	Q8VSR1	WP_023187541.1	26120140
SS00791	sopE	Guanine nucleotide exchange factor SopE (UniProt)	Salmonella enterica	Q8VSR2	WP_002953107.1	26120140
SS00792	espF(U)	Secreted effector protein EspF(U) (UniProt, NCBI)	Escherichia coli	Q8X482	Q8X482.1
SS00793	nleG2-2	T3SS secreted effector NleG (NCBI)	Escherichia coli	Q8X4X1	NP_310021.1	24391954
SS00794	espK	GogB (Reference); T3SS secreted effector EspK (UniProt, NCBI)	Escherichia coli	Q8X782	WP_000938118.1	16990433;24391954
SS00795	nleF	Effector protein NleF (UniProt)	Escherichia coli	Q8XAL7	WP_000938103.1
SS00796	st47	ST47 protein (UniProt)	Escherichia coli	Q8XBX7	EEC7188973.1	19390696
SS00797	espB	EaeB (UniProt)	Escherichia coli	Q8XC86	WP_001092000.1	19390696
SS00798	RSp1281	Putative type III effector protein (UniProt)	Ralstonia solanacearum	Q8XQE6	AST30242.1	26120140
SS00799	ripA	Type III effector protein awr1 (UniProt, NCBI)	Ralstonia solanacearum	Q8XTK9	CAD17250.1	26120140
SS00800	brg11	TAL effector protein Brg11 (UniProt)	Ralstonia solanacearum	Q8XYE3
SS00801	popP2	Type III effector protein popp2 (UniProt)	Ralstonia solanacearum	Q8Y125	WP_043876564.1	24391954
SS00802	pipB2	Secreted effector protein PipB2 (UniProt)	Salmonella enterica	Q8Z4G9	WP_001801692.1	26120140
SS00803	sseL	Deubiquitinase SseL (UniProt)	Salmonella enterica	Q8Z550	WP_001017745.1	26120140
SS00804	sseC	SPI-2 type III secretion system translocon protein SseC (NCBI)	Salmonella enterica	Q8Z6L6	WP_001079758.1	24391954
SS00805	sopB	Inositol phosphate phosphatase SopB (UniProt)	Salmonella enterica	Q8Z7R1	WP_001166955.1	21106126
SS00806	avrA	type III secretion system YopJ family effector AvrA (NCBI)	Salmonella enterica	Q8ZMI3	EBV3011379.1	26120140
SS00807	pipB2	Secreted effector protein PipB2 (UniProt)	Salmonella enterica	Q8ZMM8	AYG15287.1	26120140
SS00808	STM2614	Gifsy-1 prophage protein (UniProt)	Salmonella enterica	Q8ZMY7		26120140
SS00809	gogB	Gifsy-1 prophage leucine-rich repeat protein (UniProt)	Salmonella enterica	Q8ZN18	WP_010989047.1	24391954
SS00810	sseL	Deubiquitinase SseL (UniProt)	Salmonella enterica	Q8ZNG2	AZR55017.1	26120140
SS00811	STM2137	type III secretion system effector arginine glycosyltransferase SseK2 (NCBI)	Salmonella enterica	Q8ZNP4	WP_010989041.1	26120140
SS00812	sopA	E3 ubiquitin-protein ligase SopA (UniProt)	Salmonella enterica	Q8ZNR3	WP_000703998.1	19390696
SS00813	steC	Secreted effector kinase SteC (UniProt)	Salmonella enterica	Q8ZP57	AZR50674.1	26120140
SS00814	steB	Secreted effector protein SteB (UniProt, NCBI)	Salmonella enterica	Q8ZPA6	AQY77888.1	21106126
SS00815	steA	Secreted effector protein SteA (UniProt, NCBI)	Salmonella enterica	Q8ZPD7	AMZ52892.1	26120140
SS00816	pipB	Secreted effector protein PipB (UniProt)	Salmonella enterica	Q8ZQ59	AZR51290.1	26120140
SS00817	sseI	Secreted effector protein SseI (UniProt)	Salmonella enterica	Q8ZQ79	AZR56356.1	26120140
SS00818	STM1026	Gifsy-2 prophage protein (UniProt)	Salmonella enterica	Q8ZQA1	EDB9851882.1	26120140
SS00819	sopD2	Secreted effector protein sopD2 (UniProt)	Salmonella enterica	Q8ZQC8	AZR51399.1	26120140
SS00820	slrP	SlrP (Reference); E3 ubiquitin-protein ligase SlrP (UniProt)	Salmonella enterica	Q8ZQQ2		19690162;23437191
SS00821	yopP	Yop effector YopP (UniProt)	Yersinia enterocolitica	Q93KQ5		19390696
SS00822	yopO	Protein kinase YopO (UniProt)	Yersinia enterocolitica	Q93KQ6	WP_011100759.1	17121817
SS00823	yopM	Yop effector YopM (UniProt)	Yersinia enterocolitica	Q93KU8	AJJ21446.1	19390696
SS00824	aexT	ADP-ribosyltransferase toxin AexT (UniProt, NCBI)	Aeromonas salmonicida	Q93Q17	Q93Q17.1	23437191
SS00825	yopT	Cysteine protease YopT (UniProt, NCBI)	Pseudomonas fluorescens	Q93RN4	Q93RN4.2	19390696
SS00826	aroK	Shikimate kinase (UniProt)	Rhizobium loti	Q989M4		23437191
SS00827	mlr8763	Mlr8763 protein (UniProt)	Rhizobium loti	Q989P6		26120140
SS00828	mll6337	Nodulation protein NolX (UniProt)	Rhizobium loti	Q989P8		26120140
SS00829	mlr6316	Mlr6316 protein (UniProt)	Rhizobium loti	Q989R4		24391954
SS00830	ospG	Protein kinase OspG (UniProt)	Shigella flexneri	Q99PZ6	YP_009062537.1	23437191
SS00831	sopB	Inositol phosphate phosphatase SopB (UniProt)	Salmonella bongori	Q9AH17	AAK27357.1	26120140
SS00832	sopB	Inositol phosphate phosphatase SopB (UniProt)	Salmonella enterica	Q9AH18	AAK27356.1	26120140
SS00833	sopB	Inositol phosphate phosphatase SopB (UniProt)	Salmonella enterica	Q9AH19	AAK27355.1	26120140
SS00834	ipgB2	IpgB2 (UniProt)	Shigella flexneri	Q9AJW7	YP_009062459.1	23437191
SS00835	blr2058	Putative cysteine protease YopT-like blr2058 (UniProt, NCBI)	Bradyrhizobium diazoefficiens	Q9AMW4	Q9AMW4.1	23437191
SS00836	id636	ID636 (UniProt)	Bradyrhizobium japonicum	Q9AN16	AGH09962.1	24391954
SS00837	hrpA	Hrp pili protein HrpA (UniProt)	Pseudomonas savastanoi	Q9F0B1	AAZ35032.1
SS00838	hrcQb	Type III secretion protein HrcQb (UniProt, NCBI)	Pseudomonas syringae	Q9F0H3	WP_005763877.1
SS00839	avrPpiC2	Probable cysteine protease avirulence protein AvrPpiC2 (UniProt, NCBI)	Pseudomonas syringae	Q9F3T4	Q9F3T4.1	19390696
SS00840	avrppiG1	AvrPpiG1 protein (UniProt)	Pseudomonas syringae	Q9F3T5	WP_003349456.1	24391954
SS00841	avrPphD	Effector protein AvrPphD (UniProt)	Pseudomonas savastanoi	Q9F3T6	WP_011282444.1	26120140
SS00842	wtsE	WtsE (UniProt, NCBI)	Pantoea stewartii	Q9FCY7	AAG01467.2	23437191
SS00843	sseJ	Secreted effector protein SseJ (UniProt)	Salmonella enterica	Q9FD10	AKW02614.2	26120140
SS00844	exoT	Exoenzyme T (UniProt)	Pseudomonas aeruginosa	Q9I788	WP_003114583.1	19680249
SS00845	ALO36_02903	Type III effector HopN1 (UniProt, NCBI)	Pseudomonas syringae	Q9JP32	AAO54892.1	19390696
SS00846		ORF2 (UniProt, NCBI)	Pseudomonas savastanoi	Q9K2L5	AAF67149.1	19390696
SS00847	sifB	Secreted effector protein SifB (UniProt)	Salmonella enterica	Q9KIB9	AJQ69616.1	26120140
SS00848	tir	Tir (UniProt, NCBI)	Escherichia coli	Q9KWH9	BAA96815.1	23437191
SS00849	hrpK	type III helper protein HrpK1 (NCBI)	Pseudomonas syringae	Q9L6W3	WP_011103539.1	19390696
SS00850	ALO36_02932	Type III effector HopB1 (UniProt, NCBI)	Pseudomonas syringae	Q9L6W4	AAO54928.1	19390696
SS00851	STMF1.17	type III secretion system effector arginine glycosyltransferase SseK1 (NCBI)	Salmonella enterica	Q9L9J3	ECM2300820.1	26120140
SS00852	sseD	Secreted effector protein SseD (UniProt)	Salmonella enterica	Q9R803	ATQ02846.1	23437191
SS00853	popA	Protein PopA1 (UniProt)	Ralstonia solanacearum	Q9RBS0	WP_011004174.1	24391954
SS00854	popB	Protein PopB (UniProt, NCBI)	Ralstonia solanacearum	Q9RBS1	AKZ28783.1	24391954
SS00855	popC	Protein PopC (UniProt, NCBI)	Ralstonia solanacearum	Q9RBS2	Q9RBS2.2	24391954
SS00856	hopAB1	Effector protein hopAB1 (UniProt, NCBI)	Pseudomonas savastanoi	Q9RBW3	AAZ37972.1	24391954
SS00857	sopB	Inositol phosphate phosphatase SopB (UniProt)	Salmonella blockley	Q9RER2		21106126
SS00858	bopB	Outer protein B (UniProt, NCBI)	Bordetella bronchiseptica	Q9REZ5	AAF15898.1	24391954
SS00859	bsp22	Secreted protein 22 (UniProt)	Bordetella bronchiseptica	Q9REZ7	WP_003809882.1	23437191
SS00860	ypkA	Protein kinase YpkA (UniProt)	Yersinia pestis	Q9RI12	WP_002213290.1	26120140
SS00861	sopE	Guanine nucleotide exchange factor SopE (UniProt)	Salmonella enterica	Q9RPM6	WP_000161708.1	26120140
SS00862	incD	inclusion membrane protein IncD (NCBI)	Chlamydia trachomatis	B7SCE0	WP_009873570.1	24391954
SS00863	sopA	E3 ubiquitin-protein ligase SopA (UniProt)	Salmonella enterica	Q9S4P4	Q9S4P4.1
SS00864	avrBs2	Avirulence protein AvrBs2 (UniProt, NCBI)	Xanthomonas euvesicatoria	Q9Z3F4	CAJ21683.1	23437191
SS00865	lcrH_2	Low Calcium Response Protein H (UniProt, NCBI)	Chlamydia pneumoniae	Q9Z6N8	AAD19158.1	24391954
SS00866	yscL	Translocation protein L (UniProt)	Chlamydia pneumoniae	Q9Z780	WP_010883463.1	24391954
SS00867	CPn0821 homolog	Uncharacterized protein CPn0821 homolog (UniProt)	Chlamydia pneumoniae	Q9Z785	AAD18959.1	24391954
SS00868	CP_1108	CT648 hypothetical protein (NCBI)	Chlamydia pneumoniae	Q9Z7E2	AAD18902.1	24391954
SS00869	yscN	Probable ATP synthase YscN (UniProt)	Chlamydia pneumoniae	Q9Z7J8	WP_010883345.1	24391954
SS00870	yscC	Outer membrane secretion protein Q (UniProt)	Chlamydia pneumoniae	Q9Z7K3	WP_010883340.1	24391954
SS00871	CP_0099	CT529 hypothetical protein (NCBI)	Chlamydia pneumoniae	Q9Z7Q6	AAD18787.1	24391954
SS00872	CP_0163	CPj0585 protein (UniProt)	Chlamydia pneumoniae	Q9Z7W9	BAA98792.1	19390696
SS00873	CPn_0572	type III secretion system actin-recruiting effector Tarp (NCBI)	Chlamydia pneumoniae	Q9Z7Y1	WP_010883210.1	19390696
SS00874	CP_0264	CT387 hypothetical protein (NCBI)	Chlamydia pneumoniae	Q9Z861	AAD18630.1	24391954
SS00875	CP_0280	CT365 hypothetical protein (NCBI)	Chlamydia pneumoniae	Q9Z877	AAD18614.1	24391954
SS00876	CP_0382	peptidoglycan editing factor PgeF (NCBI)	Chlamydia pneumoniae	Q9Z8G9	WP_010883017.1	24391954
SS00877	sycE	Scc1 (UniProt, NCBI)	Chlamydia pneumoniae	Q9Z8L3	AAP98268.1	24391954
SS00878	lcrE	Low Calcium Response E (UniProt)	Chlamydia pneumoniae	Q9Z8L4	WP_010882972.1	19390696
SS00879	CP_0450	CPj0308 protein (UniProt)	Chlamydia pneumoniae	Q9Z8N0	BAA98518.1	23437191
SS00880	incC	inclusion membrane protein IncC (NCBI)	Chlamydia pneumoniae	Q9Z8P6	WP_010882940.1	19390696
SS00881	incB	inclusion membrane protein IncB (NCBI)	Chlamydia pneumoniae	Q9Z8P7	WP_010882939.1	19390696
SS00882	CPn_0206, CP_0561, CPj0206, CpB0210	Uncharacterized protein CPn_0206/CP_0561/CPj0206/CpB0210 (UniProt)	Chlamydia pneumoniae	Q9Z8X8	AAD18359.1	24391954
SS00883	CP_0581	CPj0186 protein (UniProt)	Chlamydia pneumoniae	Q9Z8Z8	WP_010882837.1	19390696
SS00884	xopQ	Type III effector protein (UniProt)	Xanthomonas oryzae	R4TJS0	AGM16438.1	26120140
SS00885	hopI1	Type III secretion system effector HopI1 (UniProt, NCBI)	Pseudomonas syringae	S3MPF6	EPF68418.1	26120140
SS00886	hopBA1	Type III secretion system effector HopBA1 (UniProt, NCBI)	Pseudomonas syringae	S3MY93	AKF51360.1	26120140
SS00887	hopAA1	Type III secretion system effector HopAA1 (UniProt, NCBI)	Pseudomonas syringae	S3NG26	EPF65306.1	26120140
SS00888	avrE1	Type III secretion system effector AvrE1 (UniPrott, NCBI)	Pseudomonas syringae	S3NG30	EPF65311.1	26120140
SS00890	Molecular chaperone DnaJ (UniProt)	Molecular chaperone DnaJ (UniProt)	Pseudomonas syringae	A0A0W0PVZ9	EPM52592.1	26120140
SS00891	A244_36138	Type III effector HopX1 (UniProt, NCBI)	Pseudomonas syringae	S6SR13	EPM70483.1	26120140
SS00892	A244_35923	Type III effector protein AvrE1 (UniProt)	Pseudomonas syringae	S6SWN6	EPN33782.1	26120140
SS00893	A244_35888	Type III effector HopAA1-1 (UniProt)	Pseudomonas syringae	S6SWQ6	EPN33802.1	26120140
SS00894	ALQ07_00754	Type III effector HopY1 (UniProt, NCBI)	Pseudomonas syringae	A0A3M4L3G7	EPM51152.1	26120140
SS00895	A244_32551	Type III effector HopAB2 (UniProt)	Pseudomonas syringae	S6T863	EPN37959.1	26120140
SS00896	A245_35725	Type III effector HopA1 (UniProt)	Pseudomonas syringae	A0A656JP60	EPN41951.1	26120140
SS00897	A244_22116	Type III effector HopAG1 (UniProt, NCBI)	Pseudomonas syringae	S6TTJ9	EPN46956.1	26120140
SS00898	A244_36148	Type III effector HopF2 (UniProt, NCBI)	Pseudomonas syringae	S6TW99	EPN33709.1	26120140
SS00899	A244_35918	Type III effector protein AvrE1 (UniProt)	Pseudomonas syringae	S6TWG5	EPN33786.1	26120140
SS00900	A244_35883	Type III effector HopAA1-1 (UniProt)	Pseudomonas syringae	S6TWP0	EPN33861.1	26120140
SS00901	A245_42480	Type III effector HopS2 (UniProt, NCBI)	Pseudomonas syringae	A0A656JKR5	EPM52286.1	26120140
SS00902	ALQ07_00790	Type III effector HopT1-2 (UniProt, NCBI)	Pseudomonas syringae	A0A3M4KMZ4	EPM52288.1	26120140
SS00903	A244_37574	Type III effector HopF2 (UniProt, NCBI)	Pseudomonas syringae	S6U3U1	EPM43426.1	26120140
SS00904	A244_17751	Type III effector HopAH2-2 (UniProt, NCBI)	Pseudomonas syringae	S6U6V3	EPN51680.1	26120140
SS00905	A245_42465	Type III effector HopO1-2 (UniProt, NCBI)	Pseudomonas syringae	A0A656JKS4	EPM52289.1	26120140
SS00906	A245_39011	Type III effector HopA1 (UniProt)	Pseudomonas syringae	A0A656JMC6	EPN38168.1	26120140
SS00907	A245_23134	Type III effector HopAH2-1 (UniProt)	Pseudomonas syringae	A0A656JUW2	EPN55544.1	26120140
SS00908	A244_01615	Type III effector HopO1-2 (UniProt, NCBI)	Pseudomonas syringae	S6V7U9	EPM52289.1	26120140
SS00909	A244_00040	Type III effector HopI1 (UniProt)	Pseudomonas syringae	S6VA78	EPN64641.1	26120140
SS00910	A244_00045	Type III effector HopI1 (UniProt)	Pseudomonas syringae	S6VCW1	EPN64627.1	26120140
SS00911	A245_06015	Type III effector HopAB2 (UniProt)	Pseudomonas syringae	A0A656K2Q9	EPN66541.1	26120140
SS00912	A244_17756	Type III effector HopAH2-1 (UniProt, NCBI)	Pseudomonas syringae	S6VK55	EPN51681.1	26120140
SS00913	A245_23149	Type III effector HopAH2-2 (UniProt, NCBI)	Pseudomonas syringae	A0A656JUY3	EPN55533.1	26120140
SS00914	A245_01978	Type III effector protein AvrE1 (UniProt)	Pseudomonas syringae	A0A656K6U3	EPN69327.1	26120140
SS00915	A245_23144	Type III effector HopAH2-1 (UniProt)	Pseudomonas syringae	A0A656JUP1	EPN55532.1	26120140
SS00916	A245_23139	Type III effector HopAH2-1 (UniProt)	Pseudomonas syringae	A0A656JUZ9	EPN55537.1	26120140
SS00917	A245_18045	Type III effector HopAG1 (UniProt, NCBI)	Pseudomonas syringae	A0A656JXQ0	EPN59302.1	26120140
SS00918	A244_07171	Type III effector HopA1 (UniProt, NCBI)	Pseudomonas syringae	S6W322	WP_017709273.1	26120140
SS00919	A245_18040	Type III effector HopAG1 (UniProt, NCBI)	Pseudomonas syringae	A0A656JXF7	EPN59301.1	26120140
SS00920	A244_01605	Type III effector HopS2 (UniProt, NCBI)	Pseudomonas syringae	S6WC57	EPM52286.1	26120140
SS00921	A244_05049	Type III effector HopY1 (UniProt, NCBI)	Pseudomonas syringae	S6WD38	EPN61762.1	26120140
SS00922	A245_02043	Type III effector HopAA1-1 (UniProt)	Pseudomonas syringae	A0A656K4D4	EPN69270.1	26120140
SS00923	A245_00015	Type III effector HopF2 (UniProt, NCBI)	Pseudomonas syringae	A0A656K8M8	EPN06973.1	26120140
SS00924	A245_02028	Type III effector HopAA1-1 (UniProt)	Pseudomonas syringae	A0A656K4E5	EPN69294.1	26120140
SS00925	A245_01993	Type III effector protein AvrE1 (UniProt)	Pseudomonas syringae	A0A656K491		26120140
SS00926	A245_01751	Type III effector HopX1 (UniProt)	Pseudomonas syringae	A0A656K4J3		26120140
SS00927	AC612_21945	Xanthomonas outer protein Q, type III effector XopQ (NCBI)	Xanthomonas citri	A0A3T0F2M8		26120140
SS00928	espD	EspD protein (NCBI)	Escherichia coli		CAA73507.1	25645555
SS00929	sseC	SseC (NCBI)	Salmonella enterica		AAC28881.1	21106126
SS00930	sseB	SseB (NCBI)	Salmonella enterica		CAA12185.1	21106126
SS00931	sseC	SseC (NCBI)	Salmonella enterica		CAA12187.1	21106126
SS00932	sseD	SseD (NCBI)	Salmonella enterica		CAA12188.1	21106126
SS00933	sseE	SseE (NCBI)	Salmonella enterica		CAA12189.1	21106126
SS00934	sseF	SseF (NCBI)	Salmonella enterica		CAA12191.1	21106126
SS00935	sseG	SseG (NCBI)	Salmonella enterica		CAA12192.1	21106126
SS00936	yopM	Yop targeted effector protein (plasmid) (NCBI)	Yersinia pestis		AAC69806.1	21106126
SS00937	yopM	Yop effector YopM (plasmid) (NCBI)	Yersinia enterocolitica		AAD16811.1	21106126
SS00938	yopM	Yop effector YopM (plasmid) (NCBI)	Yersinia enterocolitica		NP_052388.1	21106126
SS00939		Chain S, PROTEIN TYROSINE PHOSPHATASE SPTP (NCBI)	Yersinia enterocolitica		1G4U_S	21106126
SS00940		Chain R, PROTEIN TYROSINE PHOSPHATASE SPTP (NCBI)	Yersinia enterocolitica		1G4W_R	21106126
SS00941		Chain A, Crystal Structure Of The N-Terminal Domain Of The Tyrosine Phosphatase Yoph From Yersinia Pestis. (NCBI)	Yersinia enterocolitica		1HUF_A	21106126
SS00942	yopM	Yop effector YopM (plasmid) (plasmid) (NCBI)	Yersinia enterocolitica		AAK69208.1	21106126
SS00943	sseE	secretion system effector (NCBI)	Salmonella enterica		AAL20326.1	21106126
SS00944		Chain E, Structure Of The Salmonella Virulence Effector Sptp In Complex With Its Secretion Chaperone Sicp (NCBI)	Salmonella enterica		1JYO_E	21106126
SS00945		Chain A, OUTER PROTEIN YOPM (NCBI)	Salmonella enterica		1G9U_A	21106126
SS00946		Chain A, Outer Protein Yopm (NCBI)	Salmonella enterica		1JL5_A	21106126
SS00947		Chain A, Crystal Structure Of The Catalytic Domain Of Yope-Yersinia Pestis Gap Effector Protein. (NCBI)	Salmonella enterica		1HY5_A	21106126
SS00948		Chain I, Crystal Structure Of The Yersinia Virulence Effector Yope Chaperone-Binding Domain In Complex With Its Secretion Chaperone, Syce (NCBI)	Salmonella enterica		1L2W_I	21106126
SS00949		AChain A, Nmr Structure Of The Type Iii Secretory Domain Of Yersinia Yoph Complexed With The Skap-Hom Phospho-Peptide N-Acetyl- Depyddpf-Nh2 (NCBI)	Salmonella enterica		1M0V_A	21106126
SS00950	yopM	Yop effector YopM (plasmid) (NCBI)	Yersinia enterocolitica		AAN37523.1	21106126
SS00951	sspH2	secreted effector protein (NCBI)	Salmonella enterica		AG0786	21106126
SS00952	yopM	Yop effector YopM (plasmid) (NCBI)	Yersinia enterocolitica		NP_783660.1	21106126
SS00953	vopS	T3SS effector adenosine monophosphate-protein transferase VopS (NCBI)	Vibrio parahaemolyticus		WP_005464511	21106126
SS00954		secreted effector protein (NCBI)	Salmonella enterica		AAO68326.1	21106126
SS00955	avrE	AvrE, partial (NCBI)	Pseudomonas syringae		AAP31245.1	21106126
SS00956	hpaG	HpaG (NCBI)	Xanthomonas axonopodis		AAP34334.1	21106126
SS00957	yopM	outer membrane protein YopM (plasmid) (NCBI)	Yersinia pestis		NP_857756.1	21106126
SS00958	yopM	Yop targeted effector protein (plasmid) (NCBI)	Yersinia pestis		NP_857953.1	21106126
SS00959	yopM	Yop effector YopM (plasmid) (NCBI)	Yersinia enterocolitica		NP_863509.1	21106126
SS00960	sseE	secretion system effector SseE (NCBI)	Chromobacterium violaceum		AAQ60244.1	21106126
SS00961	espI	type III secretion system effector (NCBI)	Citrobacter rodentium		AAQ75736.1	15039354
SS00962	aopB	AopB (NCBI)	Aeromonas hydrophila		AAR26341.1	21106126
SS00963	nleA	non-LEE encoded effector A (NCBI)	Citrobacter rodentium		AAR84051.1	21106126
SS00964	dspE	DspE (NCBI)	Pectobacterium atrosepticum		AAS20351.1	21106126
SS00965	nleC	non-LEE encoded type III effector C (NCBI)	Citrobacter rodentium		AAS47019.1	21106126
SS00966	nleD	non-LEE encoded type III effector D (NCBI)	Citrobacter rodentium		AAS47020.1	21106126
SS00967	nleF	non-LEE-encoded type III effector F (NCBI)	Citrobacter rodentium		AAS48168.1	21106126
SS00968	nleH	non-LEE-encoded type III effector H (NCBI)	Citrobacter rodentium		AAS48169.1	21106126
SS00969	yopM	putative targeted effector protein YopM (plasmid) (NCBI)	Yersinia pestis		AAS58577.1	21106126
SS00970	yspB	YspB (NCBI)	Sodalis glossinidius		AAS66851.1	21106126
SS00971	yspA	YspA (NCBI)	Sodalis glossinidius		AAS66853.1	21106126
SS00972	aopB	AopB (NCBI)	Aeromonas hydrophila		AAS91821.1	21106126
SS00973		type III secreted effector hopPmaA (plasmid) (NCBI)	Pseudomonas syringae		AAT35179.1	21106126
SS00974		type III secreted effector hopPmaA (plasmid) (NCBI)	Pseudomonas syringae		YP_025680.1	21106126
SS00975	nleE	NleE (NCBI)	Citrobacter rodentium		AAU95471.1	21106126
SS00976	aopB	AopB (NCBI)	Aeromonas hydrophila		AAV30235.1	21106126
SS00977	eseC	EseC (NCBI)	Edwardsiella tarda		AAV69404.1	21106126
SS00978	eseD	EseD (NCBI)	Edwardsiella tarda		AAV69405.1	21106126
SS00979		AChain A, Solution Structure Of The Folded Core Of Pseudomonas Syringae Effector Protein, Avrpto (NCBI)	Edwardsiella tarda		1R5E_A	21106126
SS00980	sseF	SseF, partial (NCBI)	Salmonella enterica		AAX49626.1	21106126
SS00981	sseE	Secretion system effector SseE (NCBI)	Salmonella enterica		AAX65329.1	21106126
SS00982	eseB	EseB (NCBI)	Edwardsiella tarda		AAX76903.1	21106126
SS00983	eseD	type III secretion system effector protein D, partial (NCBI)	Edwardsiella tarda		BAE19884.1	21106126
SS00984	eseC	type III secretion system effector protein C, partial (NCBI)	Edwardsiella tarda		BAE19885.1	21106126
SS00985	tir	translocated intimin receptor (NCBI)	Escherichia coli		ABB16332.1	21106126
SS00986	tccP	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		ABB16333.1	21106126
SS00987	wtsE	WtsE (NCBI)	Pantoea stewartii		AAG01467.2	21106126
SS00988	aexT	AexT (NCBI)	Aeromonas salmonicida		ABD48949.1	21106126
SS00989	aopH	AopH (NCBI)	Aeromonas salmonicida		ABD48950.1	21106126
SS00990	aopO	AopO (NCBI)	Aeromonas salmonicida		ABD48951.1	21106126
SS00991	exoU	type three secretion system effector protein (NCBI)	Pseudomonas aeruginosa		ABD94685.1	21106126
SS00992		type three secretion effector protein (NCBI)	Pseudomonas aeruginosa		ABD94731.1	21106126
SS00993	popC	PopC (NCBI)	Xanthomonas oryzae		ABG23671.1	21106126
SS00994	aexT	AexT (NCBI)	Aeromonas veronii		ABJ98887.1	21106126
SS00995		AexU (NCBI)	Aeromonas veronii		ABJ98888.1	21106126
SS00996		Chain A, Bipd Of Burkholderia Pseudomallei (NCBI)	Aeromonas veronii		2IXR_A	21106126
SS00997		Chain A, A Proteolytically Truncated Form Of Shigella Flexneri Ipad (NCBI)	Aeromonas veronii		2J0N_A	21106126
SS00998		Chain A, Semet Substituted Shigella Flexneri Ipad (NCBI)	Aeromonas veronii		2JAA_A	21106126
SS00999	nleA1	NleA1 protein (NCBI)	Escherichia coli		CAM11313.1	21106126
SS01000	nleA2	NleA2 protein (NCBI)	Escherichia coli		CAM11314.1	21106126
SS01001	nleA3	NleA3 protein (NCBI)	Escherichia coli		CAM11315.1	21106126
SS01002	nleA4	NleA4 protein (NCBI)	Escherichia coli		CAM11316.1	21106126
SS01003	nleA5	NleA5 protein (NCBI)	Escherichia coli		CAM11317.1	21106126
SS01004	nleA6-1	NleA6-1 protein (NCBI)	Escherichia coli		CAM11318.1	21106126
SS01005	nleA6-2	NleA6-2 protein (NCBI)	Escherichia coli		CAM11319.1	21106126
SS01006	nleA7	NleA7 protein (NCBI)	Escherichia coli		CAM11320.1	21106126
SS01007	nleA8-1	NleA8-1 protein (NCBI)	Escherichia coli		CAM11321.1	21106126
SS01008	nleA8-2	NleA8-2 protein (NCBI)	Escherichia coli		CAM11322.1	21106126
SS01009	nleA9	NleA9 protein (NCBI)	Escherichia coli		CAM11323.1	21106126
SS01010	nleA10	NleA10 protein (NCBI)	Escherichia coli		CAM11324.1	21106126
SS01011	nleA11	NleA11 protein (NCBI)	Escherichia coli		CAM11325.1	21106126
SS01012	yopT	plasmid type III secretion system effector protein (plasmid) (NCBI)	Yersinia enterocolitica		CAL10029.1	21106126
SS01013	yopM	yop type III secretion system effector protein (plasmid) (NCBI)	Yersinia enterocolitica		CAL10034.1	21106126
SS01015		yop type III secretion system effector protein (plasmid) (NCBI)	Yersinia enterocolitica		WP_011117630.1	21106126
SS01016	tccP	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF45424.1	21106126
SS01017	tccP	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF45425.1	21106126
SS01018	tccP	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF45426.1	21106126
SS01019	tccP	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF45427.1	21106126
SS01020	tccP	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF45428.1	21106126
SS01021	tccP	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF45429.1	21106126
SS01022	tccP	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF45430.1	21106126
SS01023	tccP	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF45431.1	21106126
SS01024	tccP	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF45432.1	21106126
SS01025	tccP	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF45433.1	21106126
SS01026	tccP	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF45434.1	21106126
SS01027	tccP	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF45435.1	21106126
SS01028	tccP	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF45436.1	21106126
SS01029	tccP2	type III secreted effector protein (NCBI)	Escherichia coli		BAF45437.1	21106126
SS01030	tccP2	type III secreted effector protein (NCBI)	Escherichia coli		BAF45438.1	21106126
SS01031	tccP2	type III secreted effector protein (NCBI)	Escherichia coli		BAF45439.1	21106126
SS01032	tccP2	type III secreted effector protein (NCBI)	Escherichia coli		BAF45440.1	21106126
SS01033	tccP2	type III secreted effector protein (NCBI)	Escherichia coli		BAF45441.1	21106126
SS01034	tccP2	type III secreted effector protein (NCBI)	Escherichia coli		BAF45442.1	21106126
SS01035	tccP2	type III secreted effector protein (NCBI)	Escherichia coli		BAF45443.1	21106126
SS01036	tccP2	type III secreted effector protein (NCBI)	Escherichia coli		BAF45444.1	21106126
SS01037	tccP2	type III secreted effector protein (NCBI)	Escherichia coli		BAF45445.1	21106126
SS01038	tccP2	type III secreted effector protein (NCBI)	Escherichia coli		BAF45446.1	21106126
SS01039	tccP2	type III secreted effector protein (NCBI)	Escherichia coli		BAF45447.1	21106126
SS01040	tccP2	type III secreted effector protein (NCBI)	Escherichia coli		BAF45448.1	21106126
SS01041	tccP2	type III secreted effector protein (NCBI)	Escherichia coli		BAF45449.1	21106126
SS01042	tccP2	type III secreted effector protein (NCBI)	Escherichia coli		BAF45450.1	21106126
SS01043	tccP2	type III secreted effector protein (NCBI)	Escherichia coli		BAF45451.1	21106126
SS01044	tccP2	type III secreted effector protein (NCBI)	Escherichia coli		BAF45452.1	21106126
SS01045	tccP2	type III secreted effector protein (NCBI)	Escherichia coli		BAF45453.1	21106126
SS01046	tccP2	type III secreted effector protein (NCBI)	Escherichia coli		BAF45454.1	21106126
SS01047	tccP2	type III secreted effector protein (NCBI)	Escherichia coli		BAF45455.1	21106126
SS01048	tccP2	type III secreted effector protein (NCBI)	Escherichia coli		BAF45456.1	21106126
SS01049	tccP2	type III secreted effector protein (NCBI)	Escherichia coli		BAF45457.1	21106126
SS01050	tccP2	type III secreted effector protein (NCBI)	Escherichia coli		BAF45458.1	21106126
SS01051	tccP2	type III secreted effector protein (NCBI)	Escherichia coli		BAF45459.1	21106126
SS01052	tccP2	type III secreted effector protein (NCBI)	Escherichia coli		BAF45460.1	21106126
SS01053	tccP2	type III secreted effector protein (NCBI)	Escherichia coli		BAF45461.1	21106126
SS01054	tccP2	type III secreted effector protein (NCBI)	Escherichia coli		BAF45462.1	21106126
SS01055	tccP2	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF52034.1	21106126
SS01056	tccP2	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF52035.1	21106126
SS01057	tccP2	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF52358.1	21106126
SS01058	tccP2	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF52359.1	21106126
SS01059	tccP2	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF52360.1	21106126
SS01060	tccP2	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF52361.1	21106126
SS01061	tccP2	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF52363.1	21106126
SS01062	tccP2	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF52364.1	21106126
SS01063	tccP2	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF52365.1	21106126
SS01064	tccP2	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF52366.1	21106126
SS01065	tccP2	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF52367.1	21106126
SS01066	tccP2	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF52368.1	21106126
SS01067	tccP2	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF52369.1	21106126
SS01068	tccP2	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF52370.1	21106126
SS01069	tccP2	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF52371.1	21106126
SS01070	tccP2	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF52372.1	21106126
SS01071	tccP2	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF52373.1	21106126
SS01072	tccP2	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF52374.1	21106126
SS01073	tccP2	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF52375.1	21106126
SS01074	tccP2	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF52376.1	21106126
SS01075	tccP2	tir-cytoskeleton coupling protein (NCBI)	Escherichia coli		BAF52377.1	21106126
SS01076	tir	translocated intimin receptor Tir (NCBI)	Escherichia coli		BAF52548.1	21106126
SS01077	tir	TTSS effector protein AexT (NCBI)	Escherichia coli		BAF52549.1	21106126
SS01078	aexT	TTSS effector protein AexT (NCBI)	Aeromonas salmonicida		ABO92190.1	21106126
SS01079	hopA1	HopA1 (NCBI)	Pseudomonas syringae		AAF71481.2	21106126
SS01080	aexT	AexT (NCBI)	Aeromonas piscicola		ABR13262.1	21106126
SS01081	tir	leucine-rich 15-repeat translocated effector protein (plasmid) (NCBI)	Yersinia pestis		ABR14860.1	21106126
SS01082	tir	translocated intimin receptor Tir (NCBI)	Escherichia coli		BAF92845.1	21106126
SS01083	yopM	effector protein YopM (plasmid) (NCBI)	Yersinia pestis		ABX88786.1	21106126
SS01084	nleH	non-LEE-encoded effector NleH (NCBI)	Escherichia coli		BAF96518.1	21106126
SS01085		non-LEE-encoded effector NleG (NCBI)	Escherichia coli		BAF96522.1	21106126
SS01086	espJ	non-LEE-encoded effector EspJ (NCBI)	Escherichia coli		BAF96525.1	21106126
SS01087	nleH	non-LEE-encoded effector NleH (NCBI)	Escherichia coli		BAF96530.1	21106126
SS01088	espJ	non-LEE-encoded effector EspJ (NCBI)	Escherichia coli		BAF96533.1	21106126
SS01089	nleB	non-LEE-encoded effector NleB (NCBI)	Escherichia coli		BAF96538.1	21106126
SS01090	nleH	non-LEE-encoded effector NleH (NCBI)	Escherichia coli		BAF96539.1	21106126
SS01091	nleG	non-LEE-encoded effector NleG (NCBI)	Escherichia coli		BAF96540.1	21106126
SS01092	nleA	non-LEE-encoded effector NleA (NCBI)	Escherichia coli		BAF96541.1	21106126
SS01093	lcrE	low calcium response protein E (TTSS effector protein) (NCBI)	Chlamydia trachomatis		CAP03784.1	21106126
SS01094	lcrE	low calcium response protein E (TTSS effector protein) (NCBI)	Chlamydia trachomatis		CAP06738.1	21106126
SS01095		serine/threonine-protein kinase (NCBI)	Chlamydia trachomatis		WP_009873285.1	21106126
SS01096		low calcium response protein E (NCBI)	Chlamydia trachomatis		WP_009873547.1	21106126
SS01097		Chain A, Crystal Structure Of The C-Terminal Domain Of The Shigella Type Iii Effector Ipah (NCBI)	Chlamydia trachomatis		3CKD_A	21106126
SS01098		type III secretion effector, YopR family (plasmid) (NCBI)	Pseudomonas fluorescens		ACC91156.1	21106126
SS01099		secreted effector protein (NCBI)	Salmonella enterica		ACF62143.1	21106126
SS01100		secreted effector protein (NCBI)	Salmonella enterica		ACF66736.1	21106126
SS01101		T3SS secreted effector NleB-homolog (NCBI)	Escherichia coli		BAG66368.1	21106126
SS01102		T3SS secreted effector NleH-homolog (NCBI)	Escherichia coli		BAG66369.1	21106126
SS01103		T3SS secreted effector NleA-homolog (NCBI)	Escherichia coli		BAG66372.1	21106126
SS01104		T3SS secreted effector, TccP2 (NCBI)	Escherichia coli		BAG66379.1	21106126
SS01105		T3SS secreted effector NleF-homolog (NCBI)	Escherichia coli		BAG66565.1	21106126
SS01106		T3SS secreted effector EspM-homolog (NCBI)	Escherichia coli		BAG66724.1	21106126
SS01107		T3SS secreted effector NleE-homolog (NCBI)	Escherichia coli		BAG66853.1	21106126
SS01108		type III secretion system, secreted effector protein (SopE) (NCBI)	Salmonella enterica		CAR37113.1	21106126
SS01109		type III secretion system, secreted effector protein (SopE) (NCBI)	Salmonella enterica		CAR32737.1	21106126
SS01110	sspH2	secreted effector protein (NCBI)	Salmonella enterica		CAR33808.1	21106126
SS01111		Chain A, Structure Of The Cyclomodulin Cif From Pathogenic Escherichia Coli (NCBI)	Salmonella enterica		3EFY_A	21106126
SS01112		Chain A, Crystal Structure Of The Full Length Ipah3 (NCBI)	Salmonella enterica		3CVR_A	21106126
SS01113		Chain A, Structure Of The Chromobacterium Violaceum Vira (Spvc) Phosphothreonine Lyase Effector Protein (NCBI)	Salmonella enterica		3BO6_A	21106126
SS01114		Chain A, Crystal Structure Of Sifa And Skip (NCBI)	Salmonella enterica		3CXB_A	21106126
SS01115		Chain A, Novel Fold Of Vira, A Type Iii Secretion System Effector Protein From Shigella Flexneri (NCBI)	Salmonella enterica		3EE1_A	21106126
SS01116	map	Type III secretion system, translocated effector protein, LEE associated (NCBI)	Escherichia coli		CAX18572.1	21106126
SS01117	espH	Type III secretion system, translocated effector protein, LEE associated (NCBI)	Escherichia coli		CAX18574.1	21106126
SS01118	sepZ	Type III secretion system, translocated effector, LEE associated (NCBI)	Escherichia coli		CAX18581.1	21106126
SS01119	map	Type III secretion system, translocated effector protein, LEE associated (NCBI)	Escherichia coli		CAX18647.1	21106126
SS01120	espH	Type III secretion system, translocated effector protein, LEE associated (NCBI)	Escherichia coli		CAX18649.1	21106126
SS01121	map	Type III secretion system, translocated effector protein, LEE associated (NCBI)	Escherichia coli		CAX18727.1	21106126
SS01122	espH	Type III secretion system, translocated effector protein, LEE associated (NCBI)	Escherichia coli		CAX18729.1	21106126
SS01123	sepZ	Type III secretion system, translocated effector, LEE associated (NCBI)	Escherichia coli		CAX18736.1	21106126
SS01124		Chain A, The 2.6 Angstrom Crystal Structure Of Chbp, The Cif Homologue From Burkholderia Pseudomallei (NCBI)	Escherichia coli		3EIT_A	21106126
SS01125	avrA	type III effector protein (NCBI)	Ralstonia solanacearum		BAH47294.1	21106126
SS01126	popP1	type III effector protein (NCBI)	Ralstonia solanacearum		BAH47295.1	21106126
SS01127		type III effector protein (NCBI)	Ralstonia solanacearum		BAH47296.1	21106126
SS01128	ripT	type III effector protein (NCBI)	Ralstonia solanacearum		BAH47297.1	21106126
SS01129	hpx38	type III effector protein (NCBI)	Ralstonia solanacearum		BAH47298.1	21106126
SS01130	hpx40	type III effector protein (NCBI)	Ralstonia solanacearum		BAH47300.1	21106126
SS01131		Chain A, The Salmonella Virulence Effector Ssph2 Functions As A Novel E3 Ligase (NCBI)	Ralstonia solanacearum		3G06_A	21106126
SS01132	lcrE	low calcium response protein E (TTSS effector protein) (NCBI)	Chlamydia trachomatis		CAX09642.1	21106126
SS01133	pkn5	putative serine/threonine-protein kinase (TTSS effector protein) (NCBI)	Chlamydia trachomatis		CAX10239.1	21106126
SS01134	lcrE	low calcium response protein E (TTSS effector protein) (NCBI)	Chlamydia trachomatis		CAX10536.1	21106126
SS01135	pkn5	putative serine/threonine-protein kinase (TTSS effector protein) (NCBI)	Chlamydia trachomatis		CAX11132.1	21106126
SS01136		Chain A, Crystal Structure Of Cell Inhibiting Factor (Cif) From Photorhabdus Luminescens (NCBI)	Chlamydia trachomatis		3GQJ_A	21106126
SS01137		AChain A, Crystal Structure Of Cell Inhibiting Factor (Cif) From Burkholderia Pseudomallei (Cifbp) (NCBI)	Chlamydia trachomatis		3GQM_A	21106126
SS01138	nleB1	non-LEE-encoded type III secreted effector (NCBI)	Escherichia coli		ACT70724.1	21106126
SS01139	nleC	non-LEE-encoded type III secreted effector (NCBI)	Escherichia coli		ACT70725.1	21106126
SS01140	nleH1	non-LEE-encoded type III secreted effector (NCBI)	Escherichia coli		ACT70726.1	21106126
SS01141	nleA	non-LEE-encoded type III secreted effector (NCBI)	Escherichia coli		ACT71538.1	21106126
SS01142	nleH2	non-LEE-encoded type III secreted effector (NCBI)	Escherichia coli		ACT71540.1	21106126
SS01143	espM1	non-LEE-encoded type III secreted effector (NCBI)	Escherichia coli		ACT71547.1	21106126
SS01144	espJ	translocated type III secretion system effector (NCBI)	Escherichia coli		ACT72390.1	21106126
SS01145	nleB2	non-LEE-encoded type III secreted effector (NCBI)	Escherichia coli		ACT73694.1	21106126
SS01146	nleE	non-LEE-encoded type III secreted effector (NCBI)	Escherichia coli		ACT73695.1	21106126
SS01147	espF	LEE-encoded type III secreted effector (NCBI)	Escherichia coli		ACT74386.1	21106126
SS01148		type III secreted effector protein (NCBI)	Escherichia coli		ACT74398.1	21106126
SS01149	espH	LEE-encoded type III secreted effector (NCBI)	Escherichia coli		ACT74400.1	21106126
SS01150	EspG	LEE-encoded type III secreted effector (NCBI)	Escherichia coli		ACT74425.1	21106126
SS01151	avrE1	AvrE1 (NCBI)	Pseudomonas syringae		ACU65043.1	21106126
SS01152	hopM1	HopM1 (NCBI)	Pseudomonas syringae		ACU65060.1	21106126
SS01153	exoU	ExoU (NCBI)	Pseudomonas syringae		ACU65062.1	21106126
SS01154		T3SS secreted effector TccP2 (NCBI)	Escherichia coli		BAI24478.1	21106126
SS01155	espG	T3SS secreted effector EspG (NCBI)	Escherichia coli		BAI28392.1	21106126
SS01156	espZ	T3SS secreted effector EspZ (NCBI)	Escherichia coli		BAI28410.1	21106126
SS01157	espH	T3SS secreted effector EspH (NCBI)	Escherichia coli		BAI28417.1	21106126
SS01158	map	T3SS secreted effector Map (NCBI)	Escherichia coli		BAI28419.1	21106126
SS01159	espF	T3SS secreted effector EspF (NCBI)	Escherichia coli		BAI28431.1	21106126
SS01160	espF	T3SS secreted effector EspF (NCBI)	Escherichia coli		BAI32323.1	21106126
SS01161	map	T3SS secreted effector Map (NCBI)	Escherichia coli		BAI32335.1	21106126
SS01162	espH	T3SS secreted effector EspH (NCBI)	Escherichia coli		BAI32337.1	21106126
SS01163	espZ	T3SS secreted effector EspZ (NCBI)	Escherichia coli		BAI32344.1	21106126
SS01164	espG	T3SS secreted effector EspG (NCBI)	Escherichia coli		BAI32362.1	21106126
SS01165	espG	T3SS secreted effector EspG (NCBI)	Escherichia coli		BAI37516.1	21106126
SS01166	espF	T3SS secreted effector EspF (NCBI)	Escherichia coli		BAI37519.1	21106126
SS01167	map	T3SS secreted effector Map (NCBI)	Escherichia coli		BAI37531.1	21106126
SS01168	espH	T3SS secreted effector EspH (NCBI)	Escherichia coli		BAI37533.1	21106126
SS01169	espZ	T3SS secreted effector EspZ (NCBI)	Escherichia coli		BAI37540.1	21106126
SS01170		secreted effector protein (NCBI)	Salmonella enterica		CBG25278.1	21106126
SS01171	yopM	secreted effector protein (plasmid) (NCBI)	Yersinia pestis		ACY60554.1	21106126
SS01172	yopM	secreted effector protein (plasmid) (NCBI)	Yersinia pestis		ACY64328.1	21106126
SS01173		Chain A, Crystal Structure Of The Sifa-skip(ph) Complex (NCBI)	Yersinia pestis		3HW2_A	21106126
SS01174	eseD	type III secretion system effector protein D (NCBI)	Edwardsiella tarda		ACY83714.1	21106126
SS01175	eseC	type III secretion system effector protein C (NCBI)	Edwardsiella tarda		ACY83715.1	21106126
SS01176	sifA	secreted effector protein (NCBI)	Salmonella enterica		ACY87887.1	21106126
SS01177	sseE	secreted effector protein (NCBI)	Salmonella enterica		ACY88176.1	21106126
SS01178	sifB	secreted effector protein (NCBI)	Salmonella enterica		ACY88411.1	21106126
SS01179		type III secretion effector, YopR family (NCBI)	Yersinia pestis		EFA45613.1	21106126
SS01180	espS	T3SS effector protein EspS (NCBI)	Citrobacter rodentium		CBG87121.1	21106126
SS01181	espI	T3SS effector protein NleA/EspI (NCBI)	Citrobacter rodentium		CBG87122.1	15039354
SS01182	nleD-1	T3SS effector protein NleD (NCBI)	Citrobacter rodentium		CBG87356.1	21106126
SS01183	nleB1	T3SS effector protein NleB1 (NCBI)	Citrobacter rodentium		CBG87859.1	21106126
SS01184	nleE	T3SS effector protein NleE (NCBI)	Citrobacter rodentium		CBG87860.1	21106126
SS01185	nleC	T3SS effector protein NleC (NCBI)	Citrobacter rodentium		CBG88408.1	21106126
SS01186	espG	T3SS effector protein EspG (NCBI)	Citrobacter rodentium		CBG89704.1	15039354
SS01187	espF	T3SS effector protein EspF (NCBI)	Citrobacter rodentium		CBG89706.1	15039354
SS01188	espB	T3SS effector protein EspB (NCBI)	Citrobacter rodentium		CBG89710.1	21106126
SS01189	espD	T3SS translocator protein EspD (NCBI)	Citrobacter rodentium		CBG89711.1	21106126
SS01190	map	T3SS effector protein Map (NCBI)	Citrobacter rodentium		CBG89719.1	15039354
SS01191	espH	T3SS effector protein EspH (NCBI)	Citrobacter rodentium		CBG89721.1	15039354
SS01192	espZ	T3SS effector protein EspZ (NCBI)	Citrobacter rodentium		CBG89728.1	21106126
SS01193	espM3	T3SS effector protein EspM3 (NCBI)	Citrobacter rodentium		CBG89902.1	21106126
SS01194	nleD-2	T3SS effector protein NleD (NCBI)	Citrobacter rodentium		CBG90573.1	21106126
SS01195	espT	T3SS effector protein EspT (NCBI)	Citrobacter rodentium		CBG90792.1	21106126
SS01196	nleH	T3SS effector protein NleH (NCBI)	Citrobacter rodentium		CBG91572.1	21106126
SS01197	nleF	T3SS effector protein NleF (NCBI)	Citrobacter rodentium		CBG91573.1	21106126
SS01198	espJ	T3SS effector protein EspJ (NCBI)	Citrobacter rodentium		CBG91576.1	21106126
SS01199	sipA	Type III secretion effector protein SipA (NCBI)	Arsenophonus nasoniae		CBA72793.1	21106126
SS01200	yopB	type III secretion effector protein IpaD, SipD, SspD, YopB (NCBI)	Arsenophonus nasoniae		CBA72795.1	21106126
SS01201	sipB	type III secretion effector protein SipB (NCBI)	Arsenophonus nasoniae		CBA72798.1	21106126
SS01202	yscW	type III secreted effector protein YopN,Yop4b,LcrE,InvE (NCBI)	Arsenophonus nasoniae		CBA73375.1	21106126
SS01203	lcrE	low calcium response protein E (NCBI)	Chlamydia trachomatis		CBJ14605.1	21106126
SS01204	escE	escE protein (NCBI)	Escherichia coli		EKJ11176.1	26459509
SS01205	yscU	YscU (plasmid) (NCBI)	Yersinia enterocolitica		NP_052408.1	26338709
SS01206		nodulation protein NopC (plasmid) (NCBI)	Rhizobium fredii		WP_010875097.1	26341483
SS01207	nopL	nodulation protein NopL (plasmid) (NCBI)	Rhizobium fredii		WP_010875118.1	26341483
SS01208		YopT-type cysteine protease domain-containing protein (NCBI)	Rhizobium fredii		WP_010875091.1	26341483
SS01209	nopP	effector protein NopP (NCBI)	Rhizobium fredii		WP_010875098.1	26341483
SS01210	nopE1	type III effector NopE1 (NCBI)	Bradyrhizobium japonicum		AGH10037.1	26341483
SS01211	nopE2	type III effector NopE2 (NCBI)	Bradyrhizobium japonicum		AGH10050.1	26341483
SS01212		histidine kinase (NCBI)	Streptomyces		WP_030419593.1	26341483
SS01213	exoT	ExoT (NCBI)	Sinorhizobium meliloti		CAA80362.1	26451042
SS01215	espD	EspD (Reference, NCBI)	Edwardsiella sp.		AJK93307.1	28351918;26324713
SS01216	nleE	NleE (NCBI)	Escherichia coli		AJA27980.1	26096513
SS01217	nleC	T3SS effector protein NleC (NCBI)	Escherichia coli		AHY70515.1	26096513
SS01218	sboH	SboH (Reference); Chimeric type III secretion system effector protein (NCBI)	Salmonella bongori		CCC30955.1	21876672;25756944
SS01219		YopK (plasmid) (NCBI)	Yersinia pseudotuberculosis		WP_011191373.1	25691590
SS01220	bprD	BprD protein (NCBI)	Burkholderia pseudomallei		CPN43953.1	25635268
SS01221	eppA	exported protein A EppA (NCBI)	Borrelia burgdorferi		WP_010883763.1	25635268
SS01222	nleB	NleB (NCBI)	Escherichia coli		ADD55598.1	25536377
SS01223	nleF	T3SS effector protein NleF (NCBI)	Escherichia coli		AHY71029.1	25183730
SS01224		CDSF (NCBI)	Mycoplasma agalactiae		CBH40896.1	24959658
SS01225	nleD	non-LEE-encoded type III secreted effector, NleD (NCBI)	Escherichia coli		AIF92441.1	24733098
SS01226		YopM; putative targeted effector protein (plasmid) (NCBI)	Pseudomonas fluorescens		ACC91213.1	24636859
SS01227		VPA0450 (Reference); VPA0450 family T3SS effector inositol phosphatase (NCBI)	Vibrio parahaemolyticus		WP_005479246.1	24606036
SS01228	yopJ	type III secretion system effector acetyltransferase YopJ (NCBI)	Yersinia pseudotuberculosis		WP_002225474.1	24199174
SS01229	aexT	AexT, partial (NCBI)	Aeromonas veronii		ACU24693.1	24073886
SS01230	aopP	AopP (Reference); AopP (plasmid) (NCBI)	Aeromonas salmonicida		YP_009062872.1	24073886
SS02422	RSp0731	Probable trehalose-6-phosphate synthase (Alpha,alpha-trehalose-phosphate synthase udp-forming) protein (UniProt, NCBI)	Ralstonia solanacearum	Q8XRV0	CAD17882.1	25538193
SS02423	BPSS1521	hypothetical protein BMAA1518 (NCBI)	Burkholderia pseudomallei	Q63K45	AAU46031.1	25635268
SS02424	XCVd0086	hypothetical protein XCVd0086 (NCBI)	Xanthomonas campestris	Q3C018	CAJ19898.1	26104875
SS02425	rip60	Ankyrin repeat domain-containing protein (UniProt, NCBI)	Ralstonia solanacearum	D2YZZ9	WP_016725077.1	20121447
SS02426	XOO4042	DUF1615 domain-containing protein (NCBI)	Xanthomonas oryzae	Q5GVH7	WP_011260398.1	27084974
SS02427	mvpA	tRNA(fMet)-specific endonuclease VapC (UniProt)	Shigella flexneri	Q7BEJ1	O06662.1	29073283
SS02428	pWR501_0063	hypothetical protein pWR501_0063 (NCBI)	Shigella flexneri	Q7BEG8	NP_085218.1	29073283
SS02429	pWR501_0112	hypothetical protein pWR501_0112 (NCBI)	Shigella flexneri	Q9AFT7	NP_085266.1	29073283
SS02430	XCV1197	XopAV (Reference); conserved hypothetical protein (NCBI)	Xanthomonas campestris	Q3BWD5	CAJ22828.1	26104875
SS02431	yggG	YggG (Reference); Putative metalloprotease yggG (NCBI)	Salmonella enterica	Q7CPU3	EFX50805.1
SS02432	RxL23	HaRxL23 (Reference); RxLR effector candidate (UniProt)	Hyaloperonospora arabidopsidis	G3C9N9	CCC55815.1	29641586
SS02450	innB	InnB (UniProt, NCBI)	Bradyrhizobium elkanii	A0A384VCK8	ASR87851.1	30619219
SS02451	XC_4273 (XCC4186)	XopLXcc8004 (Reference)	Xanthomonas campestris pv. campestris str. 8004	Q8P390	AAY51309.1	30594633
SS02452	bel2-5	BEL2_5 (UniProt, NCBI)	Bradyrhizobium elkanii	A0A0K0WSG7	AKS25901.1	32349348
SS02453	nopP_2	Effector protein NopP (UniProt, NCBI)	Bradyrhizobium sp. CI-1B	A0A508T046	WP_139859047.1	32349348
SS02454	AG1IA_05142	AGLIP1 (Reference)	Rhizoctonia solani AG-1 IA	L8WVP3	ELU40828.1	31611861
SS02455	APS58_0500	hypothetical protein APS58_0500 (NCBI)	Acidovorax citrulli		QCX09454.1	31643123
SS02456	APS58_1000	hypothetical protein APS58_1000 (NCBI)	Acidovorax citrulli		QCX09914.1	31643123
SS02457	APS58_1448	hypothetical protein APS58_1448 (NCBI)	Acidovorax citrulli		QCX10339.1	31643123
SS02458	APS58_2974	hypothetical protein APS58_2974 (NCBI)	Acidovorax citrulli		QCX11767.1	31643123
SS02459	APS58_3297	hypothetical protein APS58_3297 (NCBI)	Acidovorax citrulli		QCX12068.1	31643123
SS02460	APS58_4095	hypothetical protein APS58_4095 (NCBI)	Acidovorax citrulli		QCX12800.1	31643123
SS02461	APS58_4116	hypothetical protein APS58_4116 (NCBI)	Acidovorax citrulli		QCX12820.1	31643123

T4SS substrate

Top

BastionHub ID	Gene Name	Brief Description	Species	UniProt ID	NCBI ID	PubMed ID
SS01231	lpg1689	lpg1689 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	P37033	WP_010947416.1	24064423
SS01232	drrA	Multifunctional virulence effector protein DrrA (UniProt, NCBI)	Legionella pneumophila	Q29ST3	WP_010948166.1
SS01233	lubX	E3 ubiquitin-protein ligase LubX (UniProt, NCBI)	Legionella pneumophila	Q5X159	Q5X159.1
SS01234	lpg3000	lpg3000 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZR83	WP_010948684.1	24064423
SS01235	legP	Dot/Icm T4SS effector LegP (NCBI)	Legionella pneumophila	Q5ZR84	WP_010948683.1	24064423
SS01236	lpg2975	lpg2975 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZRA8	WP_010948659.1	24064423
SS01237	lpg2936	Ribosomal RNA small subunit methyltransferase E (UniProt)	Legionella pneumophila	Q5ZRE6		24064423
SS01238	lpg2912	lpg2912 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZRH0		24064423
SS01239	lpg2907	hypothetical protein lpg2907 (NCBI)	Legionella pneumophila	Q5ZRH5	AAU28953.1	24064423
SS01240	lpg2888	lpg2888 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZRJ3	WP_010948574.1	24064423
SS01241	lpg2885	lpg2885 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZRJ6	WP_010948571.1	24064423
SS01242	lpg2884	lpg2884 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZRJ7	WP_010948570.1	24064423
SS01243	lpg2879	lpg2879 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZRK2	WP_010948565.1	24064423
SS01244	lpg2874	lpg2874 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZRK7	WP_010948560.1	24064423
SS01245	lpg2844	lpg2844 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZRN6	WP_010948531.1	24064423
SS01246	lpg2832	lpg2832 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZRP8	WP_010948519.1	24064423
SS01247	lpg2831	Dot/Icm type IV secretion system effector VipD (NCBI)	Legionella pneumophila	Q5ZRP9	WP_010948518.1	24064423
SS01248	lubX	E3 ubiquitin-protein ligase LubX (UniProt, NCBI)	Legionella pneumophila	Q5ZRQ0		24064423
SS01249	sidH	SidH (UniProt)	Legionella pneumophila	Q5ZRQ1	WP_010948516.1	24064423
SS01250	lpg2828	lpg2828 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZRQ2	WP_010948515.1	24064423
SS01251	lpg2826	Dot/Icm T4SS effector Ceg34 (NCBI)	Legionella pneumophila	Q5ZRQ4	WP_010948513.1	24064423
SS01252	lpg2815	T4SS effector ferrous iron transporter IroT/MavN (NCBI)	Legionella pneumophila	Q5ZRR5	WP_010948502.1	24064423
SS01253	lpg2806	hypothetical protein lpg2806 (NCBI)	Legionella pneumophila	Q5ZRS4	AAU28854.1	24064423
SS01254	lpg2804	Dot/Icm T4SS effector Lem29 (NCBI)	Legionella pneumophila	Q5ZRS6	WP_010948491.1	24064423
SS01255	lepA	Dot/Icm type IV secretion system effector LepA (NCBI)	Legionella pneumophila	Q5ZRT5	WP_010948481.1	24064423
SS01256	lpg2745	lpg2745 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZRX6	WP_010948443.1	24064423
SS01257	lpg2744	lpg2744 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZRX7	WP_010948442.1	24064423
SS01258	lpg2692	lpg2692 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZS27	WP_010948392.1	24064423
SS01259	lpg2637	lpg2637 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZS82	WP_010948337.1	24064423
SS01260	lpg2628	lpg2628 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZS91	WP_010948328.1	24064423
SS01261	lpg2603	Dot/Icm T4SS effector Lem28 (NCBI)	Legionella pneumophila	Q5ZSB6	WP_010948303.1	24064423
SS01262	lpg2591	Dot/Icm T4SS effector Ceg33 (NCBI)	Legionella pneumophila	Q5ZSC8	WP_010948291.1	24064423
SS01263	sidF	SidF, inhibitor of growth family, member 3 (UniProt)	Legionella pneumophila	Q5ZSD5	WP_010948284.1	24064423
SS01264	lpg2577	Dot/Icm T4SS effector MavM (NCBI)	Legionella pneumophila	Q5ZSE2	WP_010948277.1	24064423
SS01265	lpg2555	Lpg2555 family Dot/Icm T4SS effector hydrolase (NCBI)	Legionella pneumophila	Q5ZSG2	WP_010948257.1	24064423
SS01266	lpg2552	lpg2552 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZSG5	WP_010948254.1	24064423
SS01267	lpg2546	lpg2546 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZSH1	WP_010948248.1	24064423
SS01268	lpg2541	lpg2541 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZSH6	WP_010948243.1	24064423
SS01269	lpg2539	lpg2539 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZSH8	WP_010948241.1	24064423
SS01270	lpg2538	lpg2538 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZSH9	WP_010948240.1	24064423
SS01271	lpg2529	Dot/Icm T4SS effector Lem27 (NCBI)	Legionella pneumophila	Q5ZSI8	WP_010948231.1	24064423
SS01272	lpg2527	lpg2527 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZSJ0	WP_010948229.1	24064423
SS01273	lpg2526	Dot/Icm T4SS effector MavL (NCBI)	Legionella pneumophila	Q5ZSJ1	WP_010948228.1	24064423
SS01274	lpg2525	lpg2525 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZSJ2	WP_010948227.1	24064423
SS01275	lpg2523	Dot/Icm T4SS effector Lem26 (NCBI)	Legionella pneumophila	Q5ZSJ4	WP_010948225.1	24064423
SS01276	sidC	SidC, interaptin (UniProt)	Legionella pneumophila	Q5ZSK6	WP_010948213.1	24064423
SS01277	lpg2509	SdeD (UniProt)	Legionella pneumophila	Q5ZSK8	Dot/Icm T4SS effector deubiquitinase DupB/LaiF	24064423
SS01278	lpg2505	Chain A, MesI (Lpg2505) (NCBI)	Legionella pneumophila	Q5ZSL2	6YVG_A	24064423
SS01279	lpg2504	Dot/Icm T4SS effector Ceg32/SidI (NCBI)	Legionella pneumophila	Q5ZSL3	WP_010948206.1	24064423
SS01280	lpg2498	DUF5636 domain-containing protein (UniProt)	Legionella pneumophila	Q5ZSL9	WP_010948200.1	24064423
SS01281	lepB	LepB (UniProt)	Legionella pneumophila	Q5ZSM7	WP_010948192.1	24064423
SS01282	lpg2482	SdbC (UniProt)	Legionella pneumophila	Q5ZSN5	WP_010948184.1	24064423
SS01283	sidD	Adenosine monophosphate-protein hydrolase SidD (UniProt)	Legionella pneumophila	Q5ZSQ2	WP_010948167.1	24064423
SS01284	drrA	Multifunctional virulence effector protein DrrA (UniProt, NCBI)	Legionella pneumophila	Q5ZSQ3	WP_010948166.1	24064423
SS01285	lpg2461	lpg2461 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZSQ6	WP_010948163.1	24064423
SS01286	legA15	Dot/Icm T4SS effector AnkD/LegA15 (NCBI)	Legionella pneumophila	Q5ZSR1	WP_010948158.1	24064423
SS01287	legA14	Dot/Icm T4SS effector AnkF/LegA14/Ceg31 (NCBI)	Legionella pneumophila	Q5ZSR5	WP_010948154.1	24064423
SS01288	lpg2444	Dot/Icm T4SS effector MavI (NCBI)	Legionella pneumophila	Q5ZSS2	WP_010948147.1	24064423
SS01289	lpg2443	lpg2443 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZSS3	WP_010948146.1	24064423
SS01290	lpg2434	lpg2434 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZST2	WP_010948137.1	24064423
SS01291	lpg2425	Dot/Icm T4SS effector MavH (NCBI)	Legionella pneumophila	Q5ZSU1	WP_010948128.1	24064423
SS01292	lpg2424	Dot/Icm T4SS effector MavG (NCBI)	Legionella pneumophila	Q5ZSU2	WP_010948127.1	24064423
SS01293	lpg2422	Dot/Icm T4SS effector Lem25 (NCBI)	Legionella pneumophila	Q5ZSU4	WP_010948125.1	24064423
SS01294	lpg2420	Lpg2420 family Dot/Icm T4SS effector N-acetyltransferase (NCBI)	Legionella pneumophila	Q5ZSU6	WP_010948124.1	24064423
SS01295	lpg2411	Dot/Icm T4SS effector Lem24 (NCBI)	Legionella pneumophila	Q5ZSV5	WP_010948115.1	24064423
SS01296	lpg2409	Dot/Icm type IV secretion system effector Ceg29 (NCBI)	Legionella pneumophila	Q5ZSV7	WP_010948113.1	24064423
SS01297	lpg2407	lpg2407 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZSV9	WP_010948111.1	24064423
SS01298	lpg2406	Dot/Icm T4SS effector Lem23 (NCBI)	Legionella pneumophila	Q5ZSW0	WP_010948110.1	24064423
SS01299	lpg2382	lpg2382 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZSY4	WP_010948086.1	24064423
SS01300	lpg2375	hypothetical protein lpg2375 (NCBI)	Legionella pneumophila	Q5ZSZ1	AAU28436.1	24064423
SS01301	lpg2372	lpg2372 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZSZ4	WP_010948076.1	24064423
SS01302	lpg2370	lpg2370 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZSZ6	WP_010948074.1	24064423
SS01303	lpg2359	lpg2359 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZT06	WP_010948065.1	24064423
SS01304	lpg2351	Dot/Icm T4SS effector MavF (NCBI)	Legionella pneumophila	Q5ZT14	WP_010948057.1	24064423
SS01305	lpg2344	Dot/Icm T4SS effector MavE (NCBI)	Legionella pneumophila	Q5ZT21	WP_010948050.1	24064423
SS01306	lpg2328	Dot/Icm T4SS effector Lem22 (NCBI)	Legionella pneumophila	Q5ZT37	WP_010948034.1	24064423
SS01307	legA5	Dot/Icm T4SS effector AnkK/LegA5 (NCBI)	Legionella pneumophila	Q5ZT43	WP_010948028.1	24064423
SS01308	lpg2311	Dot/Icm T4SS effector Ceg28 (NCBI)	Legionella pneumophila	Q5ZT54	WP_010948017.1	24064423
SS01309	legA3	Dot/Icm T4SS effector AnkH/LegA3 (NCBI)	Legionella pneumophila	Q5ZT65	WP_010948006.1	24064423
SS01310	legC7	Inclusion membrane protein A (UniProt)	Legionella pneumophila	Q5ZT67	WP_010948004.1	24064423
SS01311	lpg2283	hypothetical protein lpg2283 (NCBI)	Legionella pneumophila	Q5ZT79	AAU28348.1	24064423
SS01312	lpg2271	lpg2271 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZT91	WP_010947980.1	24064423
SS01313	lpg2248	Dot/Icm T4SS effector Lem21 (NCBI)	Legionella pneumophila	Q5ZTB4	WP_010947957.1	24064423
SS01314	lpg2244	hypothetical protein lpg2244 (NCBI)	Legionella pneumophila	Q5ZTB8	AAU28309.1	24064423
SS01315	lpg2239	lpg2239 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZTC3	WP_010947948.1	24064423
SS01316	lpg2223	lpg2223 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZTD9	WP_010947932.1	24064423
SS01317	lpg2216	Purine NTPase, putative (UniProt)	Legionella pneumophila	Q5ZTE6		24064423
SS01318	legA2	Dot/Icm type IV secretion system effector LegA2 (NCBI)	Legionella pneumophila	Q5ZTE7		24064423
SS01319	lpg2200	Dot/Icm T4SS effector CegC4 (NCBI)	Legionella pneumophila	Q5ZTG2	WP_010947909.1	24064423
SS01320	lpg2199	Dot/Icm T4SS effector CegC4 (NCBI)	Legionella pneumophila	Q5ZTG3	WP_010947908.1	24064423
SS01321	lpg2176	Dot/Icm T4SS effector sphingosine 1-phosphate lyase LegS2 (NCBI)	Legionella pneumophila	Q5ZTI6	WP_010947885.1	24064423
SS01322	lpg2166	Dot/Icm T4SS effector Lem19 (NCBI)	Legionella pneumophila	Q5ZTJ5	WP_010947877.1	24064423
SS01323	lpg2164	hypothetical protein lpg2164 (NCBI)	Legionella pneumophila	Q5ZTJ7	AAU28230.1	24064423
SS01324	lpg2160	lpg2160 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZTK1	WP_010947871.1	24064423
SS01325	sidJ	T4SS meta-effector polyglutamylase SidJ (NCBI)	Legionella pneumophila	Q5ZTK6	WP_010947866.1	24064423
SS01326	lpg2153	Dot/Icm T4SS effector SdeC/LaiC (NCBI)	Legionella pneumophila	Q5ZTK8	WP_010947864.1	24064423
SS01327	lpg2149	lpg2149 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZTL2	WP_010947860.1	24064423
SS01328	lpg2147	Dot/Icm T4SS effector MavC (NCBI)	Legionella pneumophila	Q5ZTL4	WP_010947858.1	24064423
SS01329	legAU13	F-box/ankyrin repeat-containing T4SS effector AnkB (NCBI)	Legionella pneumophila	Q5ZTL7	PNL77506.1	24064423
SS01330	legK2	Dot/Icm T4SS effector LegK2 (NCBI)	Legionella pneumophila	Q5ZTM4	WP_010947848.1	24064423
SS01331	lpg2050	lpg2050 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZTV8	WP_010947766.1	24064423
SS01332	lpg1986	lpg1986 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZU22	WP_010947702.1	24064423
SS01333	setA	Subversion of eukaryotic traffic protein A (UniProt)	Legionella pneumophila	Q5ZU30	WP_010947694.1	24064423
SS01334	legG1	UVB-resistance protein UVR8 (UniProt)	Legionella pneumophila	Q5ZU32	WP_010947692.1	24064423
SS01335	lpg1972	Dot/Icm T4SS effector PieF (NCBI)	Legionella pneumophila	Q5ZU36	WP_010947688.1	24064423
SS01336	lpg1969	Dot/Icm T4SS effector PieE (NCBI)	Legionella pneumophila	Q5ZU39	WP_010947685.1	24064423
SS01337	lpg1965	Dot/Icm T4SS effector PieC/LirE (NCBI)	Legionella pneumophila	Q5ZU43	WP_010947681.1	24064423
SS01338	lpg1964	Dot/Icm T4SS effector PieB/LirD (NCBI)	Legionella pneumophila	Q5ZU44	WP_010947680.1	24064423
SS01339	lpg1963	Dot/Icm T4SS effector PieA/LirC (NCBI)	Legionella pneumophila	Q5ZU45	WP_010947679.1	24064423
SS01340	lpg1962	peptidyl-prolyl cis-trans isomerase A (cyclophilin A) (NCBI)	Legionella pneumophila	Q5ZU46	AGN14841.1	24064423
SS01341	lpg1960	Dot/Icm T4SS effector LirA (NCBI)	Legionella pneumophila	Q5ZU48	WP_010947676.1	24064423
SS01342	lpg1959	lpg1959 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZU49	WP_010947675.1	24064423
SS01343	legC4	Dot/Icm T4SS effector LegC4 (NCBI)	Legionella pneumophila	Q5ZU55	WP_010947669.1	24064423
SS01344	sec7	T4SS guanine nucleotide exchange effector RalF (NCBI)	Legionella pneumophila	Q5ZU58	WP_010947666.1	24064423
SS01345	lpg1949	Dot/Icm T4SS effector Lem17 (NCBI)	Legionella pneumophila	Q5ZU59	WP_010947665.1	24064423
SS01346	legLC4	Dot/Icm T4SS effector LegLC4 (NCBI)	Legionella pneumophila	Q5ZU60	WP_010947664.1	24064423
SS01347	lpg1947	Dot/Icm T4SS effector Lem16 (NCBI)	Legionella pneumophila	Q5ZU61	WP_010947663.1	24064423
SS01348	lpg1933	Dot/Icm T4SS effector Lem15 (NCBI)	Legionella pneumophila	Q5ZU75	WP_010947649.1	24064423
SS01349	lpg1924	lpg1924 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZU83	WP_010947641.1	24064423
SS01350	lpg1907	lpg1907 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZUA0	WP_010947624.1	24064423
SS01351	legLC8	Dot/Icm T4SS effector LegLC8 (NCBI)	Legionella pneumophila	Q5ZUB7	WP_010947607.1	24064423
SS01352	lpg1888	Lpg1888 family Dot/Icm type IV secretion system effector (NCBI)	Legionella pneumophila	Q5ZUB9	WP_010947605.1	24064423
SS01353	lpg1851	Dot/Icm T4SS effector Lem14 (NCBI)	Legionella pneumophila	Q5ZUE7	WP_010947577.1	24064423
SS01354	lpg1836	Dot/Icm T4SS effector Ceg25 (NCBI)	Legionella pneumophila	Q5ZUG2	WP_010947562.1	24064423
SS01355	lpg1822	hypothetical protein lpg1822 (NCBI)	Legionella pneumophila	Q5ZUH6	AAU27901.1	24064423
SS01356	lpg1803	lpg1803 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZUJ5	WP_010947529.1	24064423
SS01357	lpg1798	Dot/Icm T4SS effector MavB (NCBI)	Legionella pneumophila	Q5ZUK0	WP_010947524.1	24064423
SS01358	lpg1797	Dot/Icm T4SS effector RvfA (NCBI)	Legionella pneumophila	Q5ZUK1	WP_010947523.1	24064423
SS01359	lpg1776	lpg1776 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZUL7	WP_010947502.1	24064423
SS01360	lpg1752	lpg1752 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZUP1	WP_010947478.1	24064423
SS01361	lpg1751	lpg1751 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZUP2	WP_010947477.1	24064423
SS01362	legAS4	Eukaryotic huntingtin interacting protein B (UniProt)	Legionella pneumophila	Q5ZUS4	WP_010947445.1	24064423
SS01363	lpg1717	lpg1717 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZUS5	WP_010947444.1	24064423
SS01364	lpg1716	lpg1716 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZUS6	WP_010947443.1	24064423
SS01365	lpg1692	lpg1692 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZUV0	WP_010947419.1	24064423
SS01366	lpg1687	Dot/Icm T4SS effector MavA (NCBI)	Legionella pneumophila	Q5ZUV5	WP_010947414.1	24064423
SS01367	lpg1685	lpg1685 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZUV7	WP_010947412.1	24064423
SS01368	lpg1684	lpg1684 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZUV8	WP_010947411.1	24064423
SS01369	lpg1683	Dot/Icm T4SS effector RavZ (NCBI)	Legionella pneumophila	Q5ZUV9	WP_010947410.1	24064423
SS01370	lpg1670	lpg1670 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZUX2	WP_010947397.1	24064423
SS01371	lpg1667	lpg1667 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZUX5	WP_010947394.1	24064423
SS01372	lpg1666	lpg1666 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZUX6	WP_010947393.1	24064423
SS01373	lpg1663	hypothetical protein lpg1663 (NCBI)	Legionella pneumophila	Q5ZUX9	AAU27743.1	24064423
SS01374	lpg1661	lpg1661 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZUY1	WP_010947388.1	24064423
SS01375	legL3	Dot/Icm T4SS effector LegL3 (NCBI)	Legionella pneumophila	Q5ZUY2	WP_010947387.1	24064423
SS01376	lpg1654	lpg1654 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZUY8	WP_010947381.1	24064423
SS01377	sidB	SidB (UniProt)	Legionella pneumophila	Q5ZV00	WP_010947369.1	24064423
SS01378	lpg1639	lpg1639 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZV03	WP_010947366.1	24064423
SS01379	lpg1625	Dot/Icm T4SS effector Lem12 (NCBI)	Legionella pneumophila	Q5ZV17	WP_010947352.1	24064423
SS01380	lpg1621	Dot/Icm T4SS effector Ceg23 (NCBI)	Legionella pneumophila	Q5ZV21	WP_010947348.1	24064423
SS01381	lpg1598	Dot/Icm T4SS effector Lem11 (NCBI)	Legionella pneumophila	Q5ZV42	WP_010947327.1	24064423
SS01382	legC6	Dot/Icm T4SS effector LegC6 (NCBI)	Legionella pneumophila	Q5ZV52	WP_010947317.1	24064423
SS01383	lpg1578	lpg1578 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZV62	WP_010947307.1	24064423
SS01384	lpg1551	Dot/Icm T4SS effector RavY (NCBI)	Legionella pneumophila	Q5ZV89	WP_010947280.1	24064423
SS01385	lpg1496	Dot/Icm T4SS effector Lem10 (NCBI)	Legionella pneumophila	Q5ZVE4	WP_010947225.1	24064423
SS01386	lpg1491	Dot/Icm T4SS effector Lem9 (NCBI)	Legionella pneumophila	Q5ZVE9	WP_010947220.1	24064423
SS01387	lpg1489	Dot/Icm T4SS effector RavX (NCBI)	Legionella pneumophila	Q5ZVF1	WP_010947218.1	24064423
SS01388	legC5	Dot/Icm type IV secretion system effector Lgt3/LegC5 (NCBI)	Legionella pneumophila	Q5ZVF2	WP_010947217.1	24064423
SS01389	lpg1484	lpg1484 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZVF6	WP_010947213.1	24064423
SS01390	legK1	Dot/Icm type IV secretion system effector kinase LegK1 (NCBI)	Legionella pneumophila	Q5ZVF7	WP_010947212.1	24064423
SS01391	lpg1453	lpg1453 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZVI7	WP_010947182.1	24064423
SS01392	lpg1449	lpg1449 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZVJ1	WP_010947178.1	24064423
SS01393	lpg1426	Dot/Icm T4SS effector VpdC (NCBI)	Legionella pneumophila	Q5ZVL4	WP_010947155.1	24064423
SS01394	licA	Choline kinase (UniProt)	Legionella pneumophila	Q5ZVN2	WP_010947137.1	24064423
SS01395	lpg1356	TPR repeat protein (UniProt)	Legionella pneumophila	Q5ZVT4	WP_010947086.1	24064423
SS01396	sidG	SidG (UniProt)	Legionella pneumophila	Q5ZVT5	WP_010947085.1	24064423
SS01397	lpg1354	hypothetical protein lpg1354 (NCBI)	Legionella pneumophila	Q5ZVT6	AAU27436.1	24064423
SS01398	lpg1316	Dot/Icm T4SS effector RavT (NCBI)	Legionella pneumophila	Q5ZVX2	WP_010947047.1	24064423
SS01399	legC1	Dot/Icm T4SS effector LegC1 (NCBI)	Legionella pneumophila	Q5ZVX6	WP_010947043.1	24064423
SS01400	lpg1290	Dot/Icm T4SS effector Lem8 (NCBI)	Legionella pneumophila	Q5ZVZ8	WP_010947021.1	24064423
SS01401	lpg1273	lpg1273 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZW15	WP_010947004.1	24064423
SS01402	lpg1227	Dot/Icm T4SS effector VpdB (NCBI)	Legionella pneumophila	Q5ZW60	WP_010946959.1	24064423
SS01403	lpg1183	Dot/Icm T4SS effector RavS (NCBI)	Legionella pneumophila	Q5ZWA2	WP_010946917.1	24064423
SS01404	lpg1171	lpg1171 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZWB4	WP_010946905.1	24064423
SS01405	lpg1166	Dot/Icm T4SS effector RavR (NCBI)	Legionella pneumophila	Q5ZWB9	WP_010946900.1	24064423
SS01406	lpg1158	lpg1158 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZWC7	WP_010946892.1	24064423
SS01407	lpg1154	Dot/Icm T4SS effector RavQ (NCBI)	Legionella pneumophila	Q5ZWD1	WP_010946888.1	24064423
SS01408	lpg1152	Dot/Icm T4SS effector RavP (NCBI)	Legionella pneumophila	Q5ZWD3	WP_010946886.1	24064423
SS01409	lpg1148	lpg1148 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZWD7	WP_010946882.1	24064423
SS01410	lpg1145	Dot/Icm T4SS effector Lem7 (NCBI)	Legionella pneumophila	Q5ZWE0	WP_010946879.1	24064423
SS01411	lpg1144	Dot/Icm T4SS effector CegC3 (NCBI)	Legionella pneumophila	Q5ZWE1	WP_010946878.1	24064423
SS01412	lpg1137	lpg1137 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZWE8	WP_010946871.1	24064423
SS01413	lpg1129	Dot/Icm T4SS effector RavO (NCBI)	Legionella pneumophila	Q5ZWF6	WP_010946863.1	24064423
SS01414	lpg1124	lpg1124 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZWG1	WP_010946858.1	24064423
SS01415	lpg1121	Dot/Icm T4SS effector Ceg19 (NCBI)	Legionella pneumophila	Q5ZWG4	WP_010946855.1	24064423
SS01416	lpg1111	Dot/Icm T4SS effector RavN (NCBI)	Legionella pneumophila	Q5ZWH4	WP_010946845.1	24064423
SS01417	lpg1110	Dot/Icm T4SS effector Lem5 (NCBI)	Legionella pneumophila	Q5ZWH5	WP_010946844.1	24064423
SS01418	lpg1109	Dot/Icm T4SS effector RavM (NCBI)	Legionella pneumophila	Q5ZWH6	WP_010946843.1	24064423
SS01419	lpg1108	Dot/Icm type IV secretion system effector RavL (NCBI)	Legionella pneumophila	Q5ZWH7	WP_010946842.1	24064423
SS01420	lpg1106	lpg1106 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZWH9	WP_010946840.1	24064423
SS01421	lpg1101	Dot/Icm T4SS effector Lem4/SmdA (NCBI)	Legionella pneumophila	Q5ZWI4	WP_010946835.1	24064423
SS01422	lpg1083	lpg1083 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZWK2	WP_010946818.1	24064423
SS01423	lpg0969	Dot/Icm T4SS effector RavK (NCBI)	Legionella pneumophila	Q5ZWW5	WP_010946704.1	24064423
SS01424	lpg0968	Dot/Icm T4SS effector v-ATPase inhibitor SidK (NCBI)	Legionella pneumophila	Q5ZWW6	WP_010946703.1	24064423
SS01425	lpg0967	lpg0967 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZWW7	WP_010946702.1	24064423
SS01426	lpg0963	lpg0963 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZWX1	WP_010946698.1	24064423
SS01427	legL1	Dot/Icm T4SS effector LegL1 (NCBI)	Legionella pneumophila	Q5ZWY8	WP_010946680.1	24064423
SS01428	lpg0944	Dot/Icm T4SS effector RavJ (NCBI)	Legionella pneumophila	Q5ZWY9	WP_010946679.1	24064423
SS01429	lpg0940	LidA (UniProt)	Legionella pneumophila	Q5ZWZ3	WP_010946675.1	24064423
SS01430	lpg0926	Dot/Icm T4SS effector RavI (NCBI)	Legionella pneumophila	Q5ZX07	WP_010946661.1	24064423
SS01431	lpg0921	hypothetical protein lpg0921 (NCBI)	Legionella pneumophila	Q5ZX12	AAU27008.1	24064423
SS01432	lpg0898	Dot/Icm T4SS effector Ceg18 (NCBI)	Legionella pneumophila	Q5ZX35	WP_010946633.1	24064423
SS01433	lpg0796	lpg0796 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZXD5	WP_010946533.1	24064423
SS01434	lpg0733	Dot/Icm T4SS effector RavH (NCBI)	Legionella pneumophila	Q5ZXJ8	WP_010946470.1	24064423
SS01435	lem3	Phosphocholine hydrolase Lem3 (NCBI)	Legionella pneumophila	Q5ZXN5	Q5ZXN5.1	24064423
SS01436	ankX	Phosphocholine transferase AnkX (UniProt)	Legionella pneumophila	Q5ZXN6	WP_010946432.1	24064423
SS01437	lpg0645	Uncharacterized protein (UniProt)	Legionella pneumophila	Q5ZXT6		24064423
SS01438	lpg0642	Dot/Icm T4SS effector WipB (NCBI)	Legionella pneumophila	Q5ZXT9	WP_010946379.1	24064423
SS01439	lpg0634	lpg0634 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZXU7	WP_010946371.1	24064423
SS01440	sidA	SidA (UniProt)	Legionella pneumophila	Q5ZXW0	CAH11823.1	24064423
SS01441	lpg0519	Dot/Icm T4SS effector Ceg17 (NCBI)	Legionella pneumophila	Q5ZY53	WP_010946267.1	24064423
SS01442	lpg0518	lpg0518 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZY54	WP_010946266.1	24064423
SS01443	legA12	Dot/Icm T4SS effector AnkC/LegA12 (NCBI)	Legionella pneumophila	Q5ZY89	WP_010946231.1	24064423
SS01444	lpg0439	Dot/Icm T4SS effector Ceg15 (NCBI)	Legionella pneumophila	Q5ZYD3	WP_010946188.1	24064423
SS01445	lpg0437	Dot/Icm T4SS effector Ceg14/sidL (NCBI)	Legionella pneumophila	Q5ZYD5	WP_010946186.1	24064423
SS01446	legA11	Dot/Icm T4SS effector AnkJ/LegA11 (NCBI)	Legionella pneumophila	Q5ZYD6	WP_010946185.1	24064423
SS01447	lpg0405	lpg0405 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZYG7	WP_010946154.1	24064423
SS01448	legA7	Dot/Icm T4SS effector AnkG/AnkZ/LegA7 (NCBI)	Legionella pneumophila	Q5ZYG9	WP_010946152.1	24064423
SS01449	legA9	Dot/Icm T4SS effector AnkY/LegA9 (NCBI)	Legionella pneumophila	Q5ZYH0	WP_010946151.1	24064423
SS01450	lpg0401	Dot/Icm T4SS effector LegA7 (NCBI)	Legionella pneumophila	Q5ZYH1	WP_010946150.1	24064423
SS01451	lpg0393	Lpg0393 family guanine-nucleotide exchange effector (NCBI)	Legionella pneumophila	Q5ZYH9	WP_010946142.1	24064423
SS01452	vipA	VipA (UniProt)	Legionella pneumophila	Q5ZYI2	WP_010946139.1	24064423
SS01453	sdhA	SdhA, GRIP coiled-coil protein GCC185 (UniProt)	Legionella pneumophila	Q5ZYJ6	WP_010946125.1	24064423
SS01454	lpg0375	lpg0375 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZYJ7	WP_010946124.1	24064423
SS01455	lpg0365	lpg0365 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZYK7	WP_010946114.1	24064423
SS01456	lpg0364	Lpg0364 family Dot/Icm type IV secretion system effector (NCBI)	Legionella pneumophila	Q5ZYK8	WP_010946113.1	24064423
SS01457	lpg0294	lpg0294 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZYR7	WP_010946055.1	24064423
SS01458	lpg0285	Dot/Icm T4SS effector Lem2 (NCBI)	Legionella pneumophila	Q5ZYS6	WP_010946046.1	24064423
SS01459	lpg0284	Dot/Icm T4SS effector Ceg10 (NCBI)	Legionella pneumophila	Q5ZYS7	WP_010946045.1	24064423
SS01460	legG2	Dot/Icm T4SS effector LegG2 (NCBI)	Legionella pneumophila	Q5ZYT5	WP_010946037.1	24064423
SS01461	lpg0275	Dot/Icm T4SS effector SdbA (NCBI)	Legionella pneumophila	Q5ZYT6	WP_010946036.1	24064423
SS01462	lpg0260	lpg0260 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZYV1	WP_010946021.1	24064423
SS01463	lpg0254	hypothetical protein lpg0254 (NCBI)	Legionella pneumophila	Q5ZYV7	AAU26361.1	24064423
SS01464	lpg0246	Dot/Icm T4SS effector Ceg9 (NCBI)	Legionella pneumophila	Q5ZYW5	WP_010946007.1	24064423
SS01465	recN	Dot/Icm T4SS effector Ceg8 (NCBI)	Legionella pneumophila	Q5ZYX1	WP_010946001.1	24064423
SS01466	lpg0210	Dot/Icm T4SS effector RavG (NCBI)	Legionella pneumophila	Q5ZZ01	WP_010945971.1	24064423
SS01467	pkn5	Serine/threonine-protein kinase (UniProt, NCBI)	Legionella pneumophila	Q5ZZ03	WP_010945969.1	24064423
SS01468	lpg0195	Dot/Icm T4SS effector RavE (NCBI)	Legionella pneumophila	Q5ZZ16	WP_010945956.1	24064423
SS01469	lpg0191	Dot/Icm T4SS effector Ceg5 (NCBI)	Legionella pneumophila	Q5ZZ20	WP_010945952.1	24064423
SS01470	lpg0181	lpg0181 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZZ30	WP_010945942.1	24064423
SS01471	lpg0172	lpg0172 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZZ39	WP_010945933.1	24064423
SS01472	legU1	Dot/Icm type IV secretion system effector (NCBI)	Legionella pneumophila	Q5ZZ40	WP_010945932.1	24064423
SS01473	lpg0160	hypothetical protein lpg0160 (NCBI)	Legionella pneumophila	Q5ZZ51	AAU26267.1	24064423
SS01474	lpg0140	hypothetical protein lpg0140 (NCBI)	Legionella pneumophila	Q5ZZ71	AAU26247.1	24064423
SS01475	sdhB	Dot/Icm T4SS effector SdhB (NCBI)	Legionella pneumophila	Q5ZZ76	WP_080447065.1	24064423
SS01476	lpg0130	hypothetical protein lpg0130 (NCBI)	Legionella pneumophila	Q5ZZ81	AAU26237.1	24064423
SS01477	lpg0126	Dot/Icm T4SS effector CegC2 (NCBI)	Legionella pneumophila	Q5ZZ85	WP_010945887.1	24064423
SS01478	lpg0107	DUF155 domain-containing protein (UniProt)	Legionella pneumophila	Q5ZZA4		24064423
SS01479	vipF	Dot/Icm T4SS effector N-acetyltransferase VipF (NCBI)	Legionella pneumophila	Q5ZZA8	WP_010945864.1	24064423
SS01480	lpg0096	Dot/Icm T4SS effector phosphotyrosine phosphatase Ceg4 (NCBI)	Legionella pneumophila	Q5ZZB5	WP_010945857.1	24064423
SS01481	lpg0090	Dot/Icm T4SS effector Lem1 (NCBI)	Legionella pneumophila	Q5ZZC1	WP_010945851.1	24064423
SS01482	lpg0081	lpg0081 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila	Q5ZZD0	WP_010945842.1	24064423
SS01483	lpg0080	Dot/Icm T4SS effector Ceg3 (NCBI)	Legionella pneumophila	Q5ZZD1	WP_010945841.1	24064423
SS01484	lpg0059	hypothetical protein lpg0059 (NCBI)	Legionella pneumophila	Q5ZZF1	AAU26167.1	24064423
SS01485	lpg0046	hypothetical protein lpg0046 (NCBI)	Legionella pneumophila	Q5ZZG4	AAU26154.1	24064423
SS01486	lpg0038	Dot/Icm T4SS effector AnkQ/LegA10 (NCBI)	Legionella pneumophila	Q5ZZH2	WP_010945800.1	24064423
SS01487	lpg0030	hypothetical protein lpg0030 (NCBI)	Legionella pneumophila	Q5ZZI0	AAU26138.1	24064423
SS01488	lpg0021	hypothetical protein LP6_0022 (NCBI)	Legionella pneumophila	Q5ZZI9	AGN12948.1	24064423
SS01489	lpg0012	Dot/Icm T4SS effector CegC1 (NCBI)	Legionella pneumophila	Q5ZZJ8	WP_010945774.1	24064423
SS01490	lpg0008	hypothetical protein lpg0008 (NCBI)	Legionella pneumophila	Q5ZZK2	AAU26116.1	24064423
SS01491	riorf55	hypothetical protein pRi1724_p056 (NCBI)	Agrobacterium tumefaciens		NP_066636.1	23193298
SS01492	riorf146	hypothetical protein pRi1724_p147 (NCBI)	Agrobacterium tumefaciens		NP_066727.1	23193298
SS01493	riorf168	hypothetical protein pRi1724_p169 (NCBI)	Agrobacterium tumefaciens		NP_066749.1	23193298
SS01494	riorf171	hypothetical protein pRi1724_p172 (NCBI)	Agrobacterium tumefaciens		NP_066752.1	23193298
SS01495	riorf173	hypothetical protein pRi1724_p001 (NCBI)	Agrobacterium tumefaciens		NP_066581.1	23193298
SS01496	virD2	hypothetical protein pTi_142 (NCBI)	Agrobacterium tumefaciens		NP_059814.1	23193298
SS01497	virD5	hypothetical protein pTi_145 (NCBI)	Agrobacterium tumefaciens		NP_059817.1	23193298
SS01498	virE2	hypothetical protein pTi_147 (NCBI)	Agrobacterium tumefaciens		NP_059819.1	23193298
SS01499	virE3	hypothetical protein pTi_148 (NCBI)	Agrobacterium tumefaciens		NP_059820.1	23193298
SS01500	virF	hypothetical protein pTi_152 (NCBI)	Agrobacterium tumefaciens		NP_059824.1	23193298
SS01501	cagA	type IV secretion system oncogenic effector CagA (NCBI)	Helicobacter pylori		WP_000180410.1	23193298
SS01502	cagA	type IV secretion system oncogenic effector CagA (NCBI)	Helicobacter pylori		WP_000180747.1	23193298
SS01503		T-DNA border endonuclease VirD2 (NCBI)	Agrobacterium tumefaciens		WP_010974919.1	23193298
SS01504		virA/G regulated protein (NCBI)	Agrobacterium tumefaciens		WP_010974921.1	23193298
SS01505		type IV secretion system single-stranded DNA binding protein VirE2 (NCBI)	Agrobacterium tumefaciens		WP_010974922.1	23193298
SS01506		virA/G regulated protein (NCBI)	Agrobacterium tumefaciens		WP_010974923.1	23193298
SS01507		hypothetical protein (NCBI)	Agrobacterium tumefaciens		WP_010891511.1	23193298
SS01508		gamma carbonic anhydrase family protein (NCBI)	Brucella melitensis		WP_002964382.1	23193298
SS01509		low-affinity inorganic phosphate transporter (NCBI)	Coxiella burnetii		NP_819070.1	23193298
SS01510		hypothetical protein CBU_0041 (NCBI)	Coxiella burnetii		NP_819096.1	23193298
SS01511		ankyrin repeat-containing protein (NCBI)	Coxiella burnetii		NP_819125.1	23193298
SS01512		serine/threonine kinase (NCBI)	Coxiella burnetii		NP_819221.1	23193298
SS01513		hypothetical protein CBU_0295 (NCBI)	Coxiella burnetii		NP_819338.1	23193298
SS01514		hypothetical protein CBU_0410 (NCBI)	Coxiella burnetii		NP_819448.1	23193298
SS01515		hypothetical protein CBU_0425 (NCBI)	Coxiella burnetii		NP_819463.1	23193298
SS01516		ankyrin repeat-containing protein (NCBI)	Coxiella burnetii		NP_819484.1	23193298
SS01517		hypothetical protein CBU_0635 (NCBI)	Coxiella burnetii		NP_819665.1	23193298
SS01518		ankyrin repeat-containing protein (NCBI)	Coxiella burnetii		NP_819802.1	23193298
SS01519		hypothetical protein CBU_0794 (NCBI)	Coxiella burnetii		NP_819814.1	23193298
SS01520		ribosomal-protein-S18-alanine acetyltransferase (NCBI)	Coxiella burnetii		NP_819821.1	23193298
SS01521		hypothetical protein CBU_0881 (NCBI)	Coxiella burnetii		NP_819899.1	23193298
SS01522		ankyrin repeat-containing protein (NCBI)	Coxiella burnetii		NP_820208.1	23193298
SS01523		membrane-spanning protein (NCBI)	Coxiella burnetii		NP_820212.1	23193298
SS01524		17 kDa common-antigen (NCBI)	Coxiella burnetii		NP_820409.1	23193298
SS01526		hypothetical protein CBU_1460 (NCBI)	Coxiella burnetii		NP_820443.1	23193298
SS01527		hypothetical protein CBU_1543 (NCBI)	Coxiella burnetii		NP_820526.1	23193298
SS01528		membrane-spanning protein (NCBI)	Coxiella burnetii		NP_820539.1	23193298
SS01529		hypothetical protein CBU_1569 (NCBI)	Coxiella burnetii		NP_820552.1	23193298
SS01530		hypothetical protein CBU_1636 (NCBI)	Coxiella burnetii		NP_820618.1	23193298
SS01531		hypothetical protein CBU_1751 (NCBI)	Coxiella burnetii		NP_820731.1	23193298
SS01532		alpha/beta hydrolase (NCBI)	Coxiella burnetii		NP_820749.1	23193298
SS01533		hypothetical protein CBU_1823 (NCBI)	Coxiella burnetii		NP_820802.1	23193298
SS01534		hypothetical protein CBU_1825 (NCBI)	Coxiella burnetii		NP_820804.1	23193298
SS01535		hypothetical protein CBU_2052 (NCBI)	Coxiella burnetii		NP_821023.1	23193298
SS01536		Fic family protein (NCBI)	Coxiella burnetii		NP_821048.1	23193298
SS01537	ptxA	pertussis toxin ADP-ribosyltransferase subunit S1 (NCBI)	Bordetella pertussis		WP_010931648.1	23193298
SS01538	ptxB	pertussis toxin binding subunit S2 (NCBI)	Bordetella pertussis		WP_010931649.1	23193298
SS01539	ptxD	pertussis toxin subunit 4 (NCBI)	Bordetella pertussis		WP_010929491.1	23193298
SS01541	ptxC	ptxC gene product (NCBI)	Bordetella pertussis		WP_010931651.1	23193298
SS01542	bepA	T4SS effector adenylyltransferase BepA (NCBI)	Bartonella henselae		WP_011181138.1	23193298
SS01543	bepB	T4SS effector adenylyltransferase BepB (NCBI)	Bartonella henselae		WP_011181140.1	23193298
SS01544	bepC	T4SS effector adenylyltransferase BepC (NCBI)	Bartonella henselae		WP_011181141.1	23193298
SS01545	bepD	T4SS effector BepD (NCBI)	Bartonella henselae		WP_011181142.1	23193298
SS01546	bepE	T4SS effector BepE (NCBI)	Bartonella henselae		WP_011181143.1	23193298
SS01547	bepF	T4SS effector BepF (NCBI)	Bartonella henselae		WP_011181144.1	23193298
SS01548	bepG	T4SS effector BepG (NCBI)	Bartonella henselae		WP_011181145.1	23193298
SS01549	cegC1	Dot/Icm T4SS effector CegC1 (NCBI)	Legionella pneumophila		WP_010945774.1	23193298
SS01550	ankQ	Dot/Icm T4SS effector AnkQ/LegA10 (NCBI)	Legionella pneumophila		WP_010945800.1	23193298
SS01551		lpg0045 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010945807.1	23193298
SS01552	ceg3	Dot/Icm T4SS effector Ceg3 (NCBI)	Legionella pneumophila		WP_010945841.1	23193298
SS01553		lpg0081 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010945842.1	23193298
SS01554	lem1	Dot/Icm T4SS effector Lem1 (NCBI)	Legionella pneumophila		WP_010945851.1	23193298
SS01555	ceg4	Dot/Icm T4SS effector phosphotyrosine phosphatase Ceg4 (NCBI)	Legionella pneumophila		WP_010945857.1	23193298
SS01556	vipF	Dot/Icm T4SS effector N-acetyltransferase VipF (NCBI)	Legionella pneumophila		WP_010945864.1	23193298
SS01557	cegC2	Dot/Icm T4SS effector CegC2 (NCBI)	Legionella pneumophila		WP_010945887.1	23193298
SS01558	sdhB	Dot/Icm T4SS effector SdhB (NCBI)	Legionella pneumophila		WP_010945896.1	23193298
SS01559	ceg5	Dot/Icm T4SS effector Ceg5 (NCBI)	Legionella pneumophila		WP_010945952.1	23193298
SS01560	ceg7	Dot/Icm T4SS effector Ceg7 (NCBI)	Legionella pneumophila		WP_010945988.1	23193298
SS01561	sidE	T4SS effector NAD-dependent ubiquitin ligase SidE (NCBI)	Legionella pneumophila		WP_010945995.1	23193298
SS01562	ceg8	Dot/Icm T4SS effector Ceg8 (NCBI)	Legionella pneumophila		WP_010946001.1	23193298
SS01563	sdbA	Dot/Icm T4SS effector SdbA (NCBI)	Legionella pneumophila		WP_010946036.1	23193298
SS01564	ceg10	Dot/Icm T4SS effector Ceg10 (NCBI)	Legionella pneumophila		WP_010946045.1	23193298
SS01565	lem2	Dot/Icm T4SS effector Lem2 (NCBI)	Legionella pneumophila		WP_010946046.1	23193298
SS01566		lpg0294 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010946055.1	23193298
SS01567		lpg0365 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010946114.1	23193298
SS01568	vipA	Dot/Icm T4SS effector VipA (NCBI)	Legionella pneumophila		WP_010946139.1	23193298
SS01569	ankJ	Dot/Icm T4SS effector AnkJ/LegA11 (NCBI)	Legionella pneumophila		WP_010946185.1	23193298
SS01570	ceg14	Dot/Icm T4SS effector Ceg14/sidL (NCBI)	Legionella pneumophila		WP_010946186.1	23193298
SS01571		lpg0518 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010946266.1	23193298
SS01572	ceg17	unnamed protein product (NCBI)	Legionella pneumophila		WP_010946267.1	23193298
SS01573	sidA	T4SS effector SidA (NCBI)	Legionella pneumophila		WP_010946358.1	23193298
SS01574		lpg0634 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010946371.1	23193298
SS01575	wipB	Dot/Icm T4SS effector WipB (NCBI)	Legionella pneumophila		WP_010946379.1	23193298
SS01576	ankN	Dot/Icm T4SS effector AnkX (NCBI)	Legionella pneumophila		WP_010946432.1	23193298
SS01577	lem3	T4SS effector phosphocholine hydrolase Lem3 (NCBI)	Legionella pneumophila		WP_010946433.1	23193298
SS01578	ceg18	Dot/Icm T4SS effector Ceg18 (NCBI)	Legionella pneumophila		WP_010946633.1	23193298
SS01579	lidA	Dot/Icm T4SS effector LidA (NCBI)	Legionella pneumophila		WP_010946675.1	23193298
SS01580		lpg0963 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010946698.1	23193298
SS01581	sidK	Dot/Icm T4SS effector v-ATPase inhibitor SidK (NCBI)	Legionella pneumophila		WP_010946703.1	23193298
SS01582	lem4	Dot/Icm T4SS effector Lem4/SmdA (NCBI)	Legionella pneumophila		WP_010946835.1	23193298
SS01583	lem6	Dot/Icm T4SS effector Lem6 (NCBI)	Legionella pneumophila		WP_010946854.1	23193298
SS01584	ceg19	Dot/Icm T4SS effector Ceg19 (NCBI)	Legionella pneumophila		WP_010946855.1	23193298
SS01585	cegC3	Dot/Icm T4SS effector CegC3 (NCBI)	Legionella pneumophila		WP_010946878.1	23193298
SS01586	lem7	Dot/Icm T4SS effector Lem7 (NCBI)	Legionella pneumophila		WP_010946879.1	23193298
SS01587		lpg1148 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010946882.1	23193298
SS01588		lpg1158 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010946892.1	23193298
SS01589	vpdB	Dot/Icm T4SS effector VpdB (NCBI)	Legionella pneumophila		WP_010946959.1	23193298
SS01590		lpg1273 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947004.1	23193298
SS01591	lem8	Dot/Icm T4SS effector Lem8 (NCBI)	Legionella pneumophila		WP_010947021.1	23193298
SS01592	sidG	Dot/Icm T4SS effector SidG (NCBI)	Legionella pneumophila		WP_010947085.1	23193298
SS01593	vpdC	Dot/Icm T4SS effector VpdC (NCBI)	Legionella pneumophila		WP_010947155.1	23193298
SS01594	legK1	Dot/Icm type IV secretion system effector kinase LegK1 (NCBI)	Legionella pneumophila		WP_010947212.1	23193298
SS01595	lgt3	Dot/Icm type IV secretion system effector Lgt3/LegC5 (NCBI)	Legionella pneumophila		WP_010947217.1	23193298
SS01596	lem9	Dot/Icm T4SS effector Lem9 (NCBI)	Legionella pneumophila		WP_010947220.1	23193298
SS01597	lem10	Dot/Icm T4SS effector Lem10 (NCBI)	Legionella pneumophila		WP_010947225.1	23193298
SS01598	legC6	Dot/Icm T4SS effector LegC6 (NCBI)	Legionella pneumophila		WP_010947317.1	23193298
SS01599	lem11	Dot/Icm T4SS effector Lem11 (NCBI)	Legionella pneumophila		WP_010947327.1	23193298
SS01600	ceg23	Dot/Icm T4SS effector Ceg23 (NCBI)	Legionella pneumophila		WP_010947348.1	23193298
SS01601	lem12	Dot/Icm T4SS effector Lem12 (NCBI)	Legionella pneumophila		WP_010947352.1	23193298
SS01602	sidB	Dot/Icm T4SS effector SidB (NCBI)	Legionella pneumophila		WP_010947369.1	23193298
SS01603	legL3	Dot/Icm T4SS effector LegL3 (NCBI)	Legionella pneumophila		WP_010947387.1	23193298
SS01604		lpg1689 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947416.1	23193298
SS01605	ppeB	Dot/Icm T4SS effector PpeB (NCBI)	Legionella pneumophila		WP_010947429.1	23193298
SS01606		lpg1717 family Dot/Icm T4SS effector(NCBI)	Legionella pneumophila		WP_010947444.1	23193298
SS01607		lpg1751 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947477.1	23193298
SS01608	lem14	Dot/Icm T4SS effector Lem14 (NCBI)	Legionella pneumophila		WP_010947577.1	23193298
SS01609	legC2	Dot/Icm T4SS effector LegC2/YlfB (NCBI)	Legionella pneumophila		WP_010947601.1	23193298
SS01610	legLC8	Dot/Icm T4SS effector LegLC8 (NCBI)	Legionella pneumophila		WP_010947607.1	23193298
SS01611	lem15	Dot/Icm T4SS effector Lem15 (NCBI)	Legionella pneumophila		WP_010947649.1	23193298
SS01612	lem16	Dot/Icm T4SS effector Lem16 (NCBI)	Legionella pneumophila		WP_010947663.1	23193298
SS01613	legLC4	Dot/Icm T4SS effector LegLC4 (NCBI)	Legionella pneumophila		WP_010947664.1	23193298
SS01614	lem17	Dot/Icm T4SS effector Lem17 (NCBI)	Legionella pneumophila		WP_010947665.1	23193298
SS01615	ralF	T4SS guanine nucleotide exchange effector RalF (NCBI)	Legionella pneumophila		WP_010947666.1	23193298
SS01616	legL5	Dot/Icm T4SS effector LegL5 (NCBI)	Legionella pneumophila		WP_010947674.1	23193298
SS01617	lirA	Dot/Icm T4SS effector LirA (NCBI)	Legionella pneumophila		WP_010947676.1	23193298
SS01618		peptidylprolyl isomerase (NCBI)	Legionella pneumophila		WP_010947678.1	23193298
SS01619	pieA	Dot/Icm T4SS effector PieA/LirC (NCBI)	Legionella pneumophila		WP_010947679.1	23193298
SS01620	pieB	Dot/Icm T4SS effector PieB/LirD (NCBI)	Legionella pneumophila		WP_010947680.1	23193298
SS01621	pieC	Dot/Icm T4SS effector PieC/LirE (NCBI)	Legionella pneumophila		WP_010947681.1	23193298
SS01622	pieD	Dot/Icm T4SS effector PieD/LirF (NCBI)	Legionella pneumophila		WP_010947682.1	23193298
SS01623	pieE	Dot/Icm T4SS effector PieE (NCBI)	Legionella pneumophila		WP_010947685.1	23193298
SS01624	sdeC	Dot/Icm T4SS effector SdeC/LaiC (NCBI)	Legionella pneumophila		WP_010947864.1	23193298
SS01626	sidJ	T4SS meta-effector polyglutamylase SidJ (NCBI)	Legionella pneumophila		WP_010947866.1	23193298
SS01628	sdeA	T4SS effector NAD-dependent ubiquitin ligase SdeA (NCBI)	Legionella pneumophila		WP_010947868.1	23193298
SS01629	lem19	Dot/Icm T4SS effector Lem19 (NCBI)	Legionella pneumophila		WP_010947877.1	23193298
SS01630	legS2	Dot/Icm T4SS effector sphingosine 1-phosphate lyase LegS2 (NCBI)	Legionella pneumophila		WP_010947885.1	23193298
SS01631	cegC4	Dot/Icm T4SS effector CegC4 (NCBI)	Legionella pneumophila		WP_010947909.1	23193298
SS01632	lem20	Dot/Icm T4SS effector Lem20 (NCBI)	Legionella pneumophila		WP_010947925.1	23193298
SS01633	lem21	Dot/Icm T4SS effector Lem21 (NCBI)	Legionella pneumophila		WP_010947957.1	23193298
SS01634	legC7	Dot/Icm T4SS effector LegC7/YlfA (NCBI)	Legionella pneumophila		WP_010948004.1	23193298
SS01635		lpg2327 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948033.1	23193298
SS01636	lem22	Dot/Icm T4SS effector Lem22 (NCBI)	Legionella pneumophila		WP_010948034.1	23193298
SS01637	sdbC	Dot/Icm T4SS effector SdbC (NCBI)	Legionella pneumophila		WP_010948095.1	23193298
SS01638	legL7	Dot/Icm T4SS effector LegL7 (NCBI)	Legionella pneumophila		WP_010948104.1	23193298
SS01639	lem23	Dot/Icm T4SS effector Lem23 (NCBI)	Legionella pneumophila		WP_010948110.1	23193298
SS01640		lpg2407 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948111.1	23193298
SS01641	ceg29	Dot/Icm type IV secretion system effector Ceg29 (NCBI)	Legionella pneumophila		WP_010948113.1	23193298
SS01642	vpdA	Dot/Icm type IV secretion system effector VdpA (NCBI)	Legionella pneumophila		WP_010948114.1	23193298
SS01643	lem24	Dot/Icm T4SS effector Lem24 (NCBI)	Legionella pneumophila		WP_010948115.1	23193298
SS01644	lem25	Dot/Icm T4SS effector Lem25 (NCBI)	Legionella pneumophila		WP_010948125.1	23193298
SS01645	ceg30	Dot/Icm T4SS effector Ceg30 (NCBI)	Legionella pneumophila		WP_010948136.1	23193298
SS01646		multifunctional virulence effector protein DrrA (NCBI)	Legionella pneumophila		WP_010948166.1	23193298
SS01647	sidD	T4SS effector deAMPylase SidD (NCBI)	Legionella pneumophila		WP_010948167.1	23193298
SS01648	sdbB	Dot/Icm T4SS effector SdbB (NCBI)	Legionella pneumophila		WP_010948184.1	23193298
SS01649	lepB	Dot/Icm T4SS GTPase-activating effector LepB (NCBI)	Legionella pneumophila		WP_010948192.1	23193298
SS01650	ceg32	Dot/Icm T4SS effector Ceg32/SidI (NCBI)	Legionella pneumophila		WP_010948206.1	23193298
SS01651	sdjA	Dot/Icm T4SS effector SdjA (NCBI)	Legionella pneumophila		WP_010948210.1	23193298
SS01652	dupB	Dot/Icm T4SS effector deubiquitinase DupB/LaiF (NCBI)	Legionella pneumophila		WP_010948211.1	23193298
SS01653	sdcA	Dot/Icm T4SS effector SdcA (NCBI)	Legionella pneumophila		WP_010948212.1	23193298
SS01654	sidC	Dot/Icm T4SS effector SidC (NCBI)	Legionella pneumophila		WP_010948213.1	23193298
SS01655	lem26	Dot/Icm T4SS effector Lem26 (NCBI)	Legionella pneumophila		WP_010948225.1	23193298
SS01656		lpg2527 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948229.1	23193298
SS01657	lem27	Dot/Icm T4SS effector Lem27 (NCBI)	Legionella pneumophila		WP_010948231.1	23193298
SS01658	sidF	Dot/Icm T4SS effector SidF (NCBI)	Legionella pneumophila		WP_010948284.1	23193298
SS01659	ceg33	Dot/Icm T4SS effector Ceg33 (NCBI)	Legionella pneumophila		WP_010948291.1	23193298
SS01660	lem28	Dot/Icm T4SS effector Lem28 (NCBI)	Legionella pneumophila		WP_010948303.1	23193298
SS01661	wipA	Dot/Icm T4SS effector WipA (NCBI)	Legionella pneumophila		WP_010948417.1	23193298
SS01662		lpg2744 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948442.1	23193298
SS01663	lepA	Dot/Icm type IV secretion system effector LepA (NCBI)	Legionella pneumophila		WP_010948481.1	23193298
SS01664	lem29	Dot/Icm T4SS effector Lem29 (NCBI)	Legionella pneumophila		WP_010948491.1	23193298
SS01665	ceg34	Dot/Icm T4SS effector Ceg34 (NCBI)	Legionella pneumophila		WP_010948513.1	23193298
SS01666	sidH	Dot/Icm T4SS effector SidH (NCBI)	Legionella pneumophila		WP_010948516.1	23193298
SS01667		E3 ubiquitin--protein ligase (NCBI)	Legionella pneumophila		WP_010948517.1	23193298
SS01668	vipD	Dot/Icm type IV secretion system effector VipD (NCBI)	Legionella pneumophila		WP_010948518.1	23193298
SS01669	lgt2	Dot/Icm type IV secretion system effector glucosyltransferase Lgt2/LegC8 (NCBI)	Legionella pneumophila		WP_010948548.1	23193298
SS01670		lpg2874 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948560.1	23193298
SS01671	legK1	Dot/Icm type IV secretion system effector kinase LegK1 (NCBI)	Legionella pneumophila		WP_011215583.1	23193298
SS01672		protein kinase (NCBI)	Legionella pneumophila		WP_011216046.1	23193298
SS01673	legK3	Dot/Icm T4SS effector LegK3 (NCBI)	Legionella pneumophila		WP_011216437.1	23193298
SS01675		hypothetical protein (NCBI)	Anaplasma marginale		WP_011114156.1	23193298
SS01676		hypothetical protein (NCBI)	Anaplasma marginale		WP_011114288.1	23193298
SS01677		ankyrin repeat domain-containing protein (NCBI)	Anaplasma marginale		WP_011114402.1	23193298
SS01680		FliO/MopB (NCBI)	Brucella melitensis		WP_002966824.1	23193298
SS01683		PepSY domain-containing protein (NCBI)	Brucella melitensis		WP_002969602.1	23193298
SS01684		cyclic nucleotide-binding domain-containing protein (NCBI)	Brucella melitensis		WP_002965067.1	23193298
SS01685		hypothetical protein (NCBI)	Brucella melitensis		WP_002966455.1	23193298
SS01687	ankA	T4SS effector DNA-binding phosphoprotein AnkA (NCBI)	Anaplasma phagocytophilum		WP_011450840.1	23193298
SS01688		hypothetical protein (NCBI)	Ehrlichia chaffeensis		WP_011452831.1	23193298
SS01689	cagA	type IV secretion system oncogenic effector CagA (NCBI)	Helicobacter pylori		WP_000180786.1	23193298
SS01690	ankG	ankyrin repeat domain-containing T4SS effector AnkG (NCBI)	Coxiella burnetii		WP_011996770.1	23193298
SS01692	ankM	Dot/Icm T4SS effector AnkM (NCBI)	Coxiella burnetii		WP_011996490.1	23193298
SS01695	cagA	type IV secretion system oncogenic effector CagA (NCBI)	Helicobacter pylori		WP_001262964.1	23193298
SS01696		rcorf28 (plasmid) (NCBI)	Agrobacterium tumefaciens		YP_001961003.1	23193298
SS01697		rcorf114 (plasmid) (NCBI)	Agrobacterium tumefaciens		YP_001961089.1	23193298
SS01698		rcorf138 (plasmid) (NCBI)	Agrobacterium tumefaciens		YP_001961113.1	23193298
SS01699		rcorf141 (plasmid) (NCBI)	Agrobacterium tumefaciens		YP_001961116.1	23193298
SS01700		rcorf143 (plasmid) (NCBI)	Agrobacterium tumefaciens		YP_001961118.1	23193298
SS01701	cagA	type IV secretion system oncogenic effector CagA (NCBI)	Helicobacter pylori		WP_000180783.1	23193298
SS01702		ankyrin repeat domain-containing protein (NCBI)	Coxiella burnetii		WP_011996917.1	23193298
SS01703	ankP	ankyrin repeat domain-containing T4SS effector AnkP (NCBI)	Coxiella burnetii		WP_011997383.1	23193298
SS01704	cagA	type IV secretion system oncogenic effector CagA (NCBI)	Helicobacter pylori		WP_000180788.1	23193298
SS01706	bamC	outer membrane protein assembly factor BamC (NCBI)	Coxiella burnetii		WP_012569937.1	23193298
SS01707	ankG	ankyrin repeat domain-containing T4SS effector AnkG (NCBI)	Coxiella burnetii		WP_012570162.1	23193298
SS01708		ankyrin repeat domain-containing protein (NCBI)	Coxiella burnetii		WP_012570282.1	23193298
SS01709	ankF	ankyrin repeat domain-containing T4SS effector AnkF (NCBI)	Coxiella burnetii		WP_010957582.1	23193298
SS01711		ankyrin repeat domain-containing protein (NCBI)	Coxiella burnetii		WP_005771199.1	23193298
SS01712	ankF	ankyrin repeat domain-containing T4SS effector AnkF (NCBI)	Coxiella burnetii		WP_005771371.1	23193298
SS01713		ankyrin repeat domain-containing protein (NCBI)	Coxiella burnetii		WP_005769508.1	23193298
SS01714		hypothetical protein CBU_0937 (NCBI)	Coxiella burnetii		NP_819950.2	23193298
SS01715		hypothetical protein CBU_1045a (NCBI)	Coxiella burnetii		YP_002332980.1	23193298
SS01716		hypothetical protein CBU_1314 (NCBI)	Coxiella burnetii		NP_820305.	23193298
SS01717		hypothetical protein CBU_1379a (NCBI)	Coxiella burnetii		YP_002333001.1	23193298
SS01718		hypothetical protein CBU_2056 (NCBI)	Coxiella burnetii		NP_821027.2	23193298
SS01720		hypothetical protein (NCBI)	Coxiella burnetii		WP_011109645.1	23193298
SS01721		CBUA0020 family Dot/Icm T4SS effector (NCBI)	Coxiella burnetii		WP_012219989.1	23193298
SS01723		hypothetical protein (NCBI)	Coxiella burnetii		WP_012220000.1	23193298
SS01725	cagA	type IV secretion system oncogenic effector CagA (NCBI)	Helicobacter pylori		WP_001262965.1	23193298
SS01726	ankH	Dot/Icm T4SS effector AnkH (NCBI)	Coxiella burnetii		WP_011996878.1	23193298
SS01727		YjdF family protein(NCBI)	Coxiella burnetii		WP_011996398.1	23193298
SS01728		hypothetical protein (NCBI)	Legionella pneumophila		WP_010945770.1	23382224
SS01729		hypothetical protein (NCBI)	Legionella pneumophila		WP_010945792.1	23382224
SS01730		RMD1 family protein (NCBI)	Legionella pneumophila		WP_010945868.1	23382224
SS01731		hypothetical protein (NCBI)	Legionella pneumophila		WP_010945891.1	23382224
SS01732		hypothetical protein (NCBI)	Legionella pneumophila		WP_010945901.1	23382224
SS01733	legU1	Dot/Icm type IV secretion system effector LegU1 (NCBI)	Legionella pneumophila		WP_010945932.1	23382224
SS01734		lpg0172 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010945933.1	23382224
SS01735		lpg0181 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010945942.1	23382224
SS01736	ravE	Dot/Icm T4SS effector RavE (NCBI)	Legionella pneumophila		WP_010945956.1	23382224
SS01737	ravF	Dot/Icm T4SS effector RavF (NCBI)	Legionella pneumophila		WP_010945957.1	23382224
SS01738		protein kinase (NCBI)	Legionella pneumophila		WP_010945969.1	23382224
SS01739		hypothetical protein (NCBI)	Legionella pneumophila		WP_010945970.1	23382224
SS01740	ravG	Dot/Icm T4SS effector RavG (NCBI)	Legionella pneumophila		WP_010945971.1	23382224
SS01741	ceg9	Dot/Icm T4SS effector Ceg9 (NCBI)	Legionella pneumophila		WP_010946007.1	23382224
SS01742		hypothetical protein (NCBI)	Legionella pneumophila		WP_010946015.1	23382224
SS01743		lpg0260 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010946021.1	23382224
SS01744		Lpg0393 family guanine-nucleotide exchange effector (NCBI)	Legionella pneumophila		WP_010946142.1	23382224
SS01745	legA7	Dot/Icm T4SS effector LegA7 (NCBI)	Legionella pneumophila		WP_010946150.1	23382224
SS01746	ankY	Dot/Icm T4SS effector AnkY/LegA9 (NCBI)	Legionella pneumophila		WP_010946151.1	23382224
SS01747	ankG	Dot/Icm T4SS effector AnkG/AnkZ/LegA7 (NCBI)	Legionella pneumophila		WP_010946152.1	23382224
SS01748		lpg0405 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010946154.1	23382224
SS01749		type I secretion C-terminal target domain-containing protein (NCBI)	Legionella pneumophila		WP_010946382.1	23382224
SS01750		hypothetical protein (NCBI)	Legionella pneumophila		WP_010946656.1	23382224
SS01751	ravI	Dot/Icm T4SS effector RavI (NCBI)	Legionella pneumophila		WP_010946661.1	23382224
SS01752	ravJ	Dot/Icm T4SS effector RavJ (NCBI)	Legionella pneumophila		WP_010946679.1	23382224
SS01753	legL1	Dot/Icm T4SS effector LegL1 (NCBI)	Legionella pneumophila		WP_010946680.1	23382224
SS01754		lpg0967 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010946702.1	23382224
SS01755	ravK	Dot/Icm T4SS effector RavK (NCBI)	Legionella pneumophila		WP_010946704.1	23382224
SS01756		lpg1083 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010946818.1	23382224
SS01757		lpg1106 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010946840.1	23382224
SS01758	ravL	Dot/Icm type IV secretion system effector RavL (NCBI)	Legionella pneumophila		WP_010946842.1	23382224
SS01759	ravM	Dot/Icm T4SS effector RavM (NCBI)	Legionella pneumophila		WP_010946843.1	23382224
SS01760	lem5	Dot/Icm T4SS effector Lem5 (NCBI)	Legionella pneumophila		WP_010946844.1	23382224
SS01761	ravN	Dot/Icm T4SS effector RavN (NCBI)	Legionella pneumophila		WP_010946845.1	23382224
SS01762		lpg1124 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010946858.1	23382224
SS01763	ravO	Dot/Icm T4SS effector RavO (NCBI)	Legionella pneumophila		WP_010946863.1	23382224
SS01764		lpg1137 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010946871.1	23382224
SS01765		Lpg1147 family Dot/Icm T4SS effector N-acetyltransferase (NCBI)	Legionella pneumophila		WP_010946881.1	23382224
SS01766	ravP	Dot/Icm T4SS effector RavP (NCBI)	Legionella pneumophila		WP_010946886.1	23382224
SS01767	ravQ	Dot/Icm T4SS effector RavQ (NCBI)	Legionella pneumophila		WP_010946888.1	23382224
SS01768	ravR	Dot/Icm T4SS effector RavR (NCBI)	Legionella pneumophila		WP_010946900.1	23382224
SS01769		lpg1171 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010946905.1	23382224
SS01770	ravS	Dot/Icm T4SS effector RavS (NCBI)	Legionella pneumophila		WP_010946917.1	23382224
SS01771	legC1	Dot/Icm T4SS effector LegC1 (NCBI)	Legionella pneumophila		WP_010947043.1	23382224
SS01772	ravT	Dot/Icm T4SS effector RavT (NCBI)	Legionella pneumophila		WP_010947047.1	23382224
SS01773	ravW	Dot/Icm T4SS effector RavW (NCBI)	Legionella pneumophila		WP_010947048.1	23382224
SS01774		SGNH/GDSL hydrolase family protein (NCBI)	Legionella pneumophila		WP_010947084.1	23382224
SS01775		SEL1-like repeat protein (NCBI)	Legionella pneumophila		WP_010947086.1	23382224
SS01776		glucosyltransferase Lgt1 (NCBI)	Legionella pneumophila		WP_010947098.1	23382224
SS01777		phosphotransferase family protein (NCBI)	Legionella pneumophila		WP_010947137.1	23382224
SS01778		lpg1449 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947178.1	23382224
SS01779		lpg1453 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947182.1	23382224
SS01780		lpg1484 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947213.1	23382224
SS01781	ravX	Dot/Icm T4SS effector RavX (NCBI)	Legionella pneumophila		WP_010947218.1	23382224
SS01782	ravY	Dot/Icm T4SS effector RavY (NCBI)	Legionella pneumophila		WP_010947280.1	23382224
SS01783		lpg1578 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947307.1	23382224
SS01784	legL2	Dot/Icm T4SS effector LegL2 (NCBI)	Legionella pneumophila		WP_010947329.1	23382224
SS01785		lpg1639 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947366.1	23382224
SS01786		lpg1654 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947381.1	23382224
SS01787		lpg1661 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947388.1	23382224
SS01788		hypothetical protein (NCBI)	Legionella pneumophila		WP_010947390.1	23382224
SS01789		lpg1666 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947393.1	23382224
SS01790		lpg1667 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947394.1	23382224
SS01791		lpg1670 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947397.1	23382224
SS01792	ravZ	Dot/Icm T4SS effector RavZ (NCBI)	Legionella pneumophila		WP_010947410.1	23382224
SS01793		lpg1684 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947411.1	23382224
SS01794		lpg1685 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947412.1	23382224
SS01795	mavA	Dot/Icm T4SS effector MavA (NCBI)	Legionella pneumophila		WP_010947414.1	23382224
SS01796		lpg1692 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947419.1	23382224
SS01797	legC3	Dot/Icm type IV secretion system effector LegC3/PpeA (NCBI)	Legionella pneumophila		WP_010947428.1	23382224
SS01798		lpg1716 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947443.1	23382224
SS01799	ankI	Dot/Icm T4SS effector AnkI/LegAS4 (NCBI)	Legionella pneumophila		WP_010947445.1	23382224
SS01800		lpg1752 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947478.1	23382224
SS01801		lpg1776 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947502	23382224
SS01802	rvfA	Dot/Icm T4SS effector RvfA (NCBI)	Legionella pneumophila		WP_010947523.1	23382224
SS01803	mavB	Dot/Icm T4SS effector MavB (NCBI)	Legionella pneumophila		WP_010947524.1	23382224
SS01804		lpg1803 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947529.1	23382224
SS01805		hypothetical protein (NCBI)	Legionella pneumophila		WP_010947548.1	23382224
SS01806	ceg25	Dot/Icm T4SS effector Ceg25 (NCBI)	Legionella pneumophila		WP_010947562.1	23382224
SS01807		Lpg1888 family Dot/Icm type IV secretion system effector (NCBI)	Legionella pneumophila		WP_010947605.1	23382224
SS01808		lpg1907 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947624.1	23382224
SS01809		lpg1924 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947641.1	23382224
SS01810	legC4	Dot/Icm T4SS effector LegC4 (NCBI)	Legionella pneumophila		WP_010947669.1	23382224
SS01811		lpg1959 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947675.1	23382224
SS01812	pieF	Dot/Icm T4SS effector PieF (NCBI)	Legionella pneumophila		WP_010947688.1	23382224
SS01813	pieG	Dot/Icm T4SS effector PieG/LegG1 (NCBI)	Legionella pneumophila		WP_010947692.1	23382224
SS01814	setA	Dot/Icm T4SS effector SetA (NCBI)	Legionella pneumophila		WP_010947694.1	23382224
SS01815		lpg1986 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947702.1	23382224
SS01816		lpg2050 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947766.1	23382224
SS01817	legK2	Dot/Icm T4SS effector LegK2 (NCBI)	Legionella pneumophila		WP_010947848.1	23382224
SS01818		F-box-like domain-containing protein (NCBI)	Legionella pneumophila		WP_010947855.1	23382224
SS01819	mavC	Dot/Icm T4SS effector MavC (NCBI)	Legionella pneumophila		WP_010947858.1	23382224
SS01820		lpg2148 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947859.1	23382224
SS01821		lpg2149 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947860.1	23382224
SS01822		lpg2160 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947871.1	23382224
SS01823		hypothetical protein (NCBI)	Legionella pneumophila		WP_010947875.1	23382224
SS01824	cegC4	Dot/Icm T4SS effector CegC4 (NCBI)	Legionella pneumophila		WP_010947908.1	23382224
SS01825	legA2	Dot/Icm type IV secretion system effector LegA2 (NCBI)	Legionella pneumophila		WP_010947924.1	23382224
SS01826	lpnE	Dot/Icm type IV secretion system effector LpnE (NCBI)	Legionella pneumophila		WP_010947931.1	23382224
SS01827		lpg2223 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947932.1	23382224
SS01828	ppgA	Dot/Icm T4SS effector PpgA (NCBI)	Legionella pneumophila		WP_010947933.1	23382224
SS01829		lpg2239 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947948.1	23382224
SS01830		hypothetical protein (NCBI)	Legionella pneumophila		WP_010947953.1	23382224
SS01831		lpg2271 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010947980.1	23382224
SS01832		hypothetical protein (NCBI)	Legionella pneumophila		WP_010947992.1	23382224
SS01833	ankH	Dot/Icm T4SS effector AnkH/LegA3 (NCBI)	Legionella pneumophila		WP_010948006.1	23382224
SS01834	ceg28	Dot/Icm T4SS effector Ceg28 (NCBI)	Legionella pneumophila		WP_010948017.1	23382224
SS01835	ankK	Dot/Icm T4SS effector AnkK/LegA5 (NCBI)	Legionella pneumophila		WP_010948028.1	23382224
SS01836	mavE	Dot/Icm T4SS effector MavE (NCBI)	Legionella pneumophila		WP_010948050.1	23382224
SS01837	mavF	Dot/Icm T4SS effector MavF (NCBI)	Legionella pneumophila		WP_010948057.1	23382224
SS01838		lpg2359 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948065.1	23382224
SS01839		lpg2370 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948074.1	23382224
SS01840		lpg2372 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948076.1	23382224
SS01841		hypothetical protein (NCBI)	Legionella pneumophila		WP_010948079.1	23382224
SS01842		lpg2382 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948086.1	23382224
SS01843	legL6	Dot/Icm T4SS effector LegL6 (NCBI)	Legionella pneumophila		WP_010948096.1	23382224
SS01844		Lpg2420 family Dot/Icm T4SS effector N-acetyltransferase (NCBI)	Legionella pneumophila		WP_010948124.1	23382224
SS01845	mavG	Dot/Icm T4SS effector MavG (NCBI)	Legionella pneumophila		WP_010948127.1	23382224
SS01846	mavH	Dot/Icm T4SS effector MavH (NCBI)	Legionella pneumophila		WP_010948128.1	23382224
SS01847		lpg2434 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948137.1	23382224
SS01848		lpg2443 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948146.1	23382224
SS01849	mavI	Dot/Icm T4SS effector MavI (NCBI)	Legionella pneumophila		WP_010948147.1	23382224
SS01850	ankF	Dot/Icm T4SS effector AnkF/LegA14/Ceg31 (NCBI)	Legionella pneumophila		WP_010948154.1	23382224
SS01851	ankD	Dot/Icm T4SS effector AnkD/LegA15 (NCBI)	Legionella pneumophila		WP_010948158.1	23382224
SS01852		lpg2461 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948163.1	23382224
SS01853	mavJ	Dot/Icm T4SS effector MavJ (NCBI)	Legionella pneumophila		WP_010948200.1	23382224
SS01854		lpg2505 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948207.1	23382224
SS01855		lpg2525 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948227.1	23382224
SS01856	mavL	Dot/Icm T4SS effector MavL (NCBI)	Legionella pneumophila		WP_010948228.1	23382224
SS01857		lpg2538 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948240.1	23382224
SS01858		lpg2539 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948241.1	23382224
SS01859		lpg2541 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948243.1	23382224
SS01860		lpg2546 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948248.1	23382224
SS01861		lpg2552 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948254.1	23382224
SS01862		Lpg2555 family Dot/Icm T4SS effector hydrolase (NCBI)	Legionella pneumophila		WP_010948257.1	23382224
SS01863	legK3	Dot/Icm T4SS effector LegK3 (NCBI)	Legionella pneumophila		WP_010948258.1	23382224
SS01864	mavM	Dot/Icm T4SS effector MavM (NCBI)	Legionella pneumophila		WP_010948277.1	23382224
SS01865		lpg2628 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948328.1	23382224
SS01866		lpg2637 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948337.1	23382224
SS01867	mavV	Dot/Icm T4SS effector MavV (NCBI)	Legionella pneumophila		WP_010948338.1	23382224
SS01868		lpg2692 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948392.1	23382224
SS01869		lpg2745 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948443.1	23382224
SS01870		hypothetical protein (NCBI)	Legionella pneumophila		WP_010948493.1	23382224
SS01871	iroT	T4SS effector ferrous iron transporter IroT/MavN (NCBI)	Legionella pneumophila		WP_010948502.1	23382224
SS01872		lpg2828 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948515.1	23382224
SS01873		lpg2832 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948519.1	23382224
SS01874		lpg2844 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948531.1	23382224
SS01875		lpg2879 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948565.1	23382224
SS01876		lpg2884 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948570.1	23382224
SS01877		lpg2885 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948571.1	23382224
SS01878		lpg2888 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948574.1	23382224
SS01879		hypothetical protein (NCBI)	Legionella pneumophila		WP_010948592.1	23382224
SS01880		lpg2912 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948597.1	23382224
SS01881		Lpg2936 family Dot/Icm T4SS effector methyltransferase (NCBI)	Legionella pneumophila		WP_010948621.1	23382224
SS01882		lpg2975 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948659.1	23382224
SS01883	legP	Dot/Icm T4SS effector LegP (NCBI)	Legionella pneumophila		WP_010948683.1	23382224
SS01884		lpg3000 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010948684.1	23382224
SS01885		hypothetical protein CBU_0388 (NCBI)	Coxiella burnetii		NP_819427.1	24064423
SS01886		hypothetical protein CBU_0626 (NCBI)	Coxiella burnetii		NP_819656.1	24064423
SS01887		hypothetical protein CBU_0885 (NCBI)	Coxiella burnetii		NP_819902.2	24064423
SS01888		hypothetical protein CBU_1686 (NCBI)	Coxiella burnetii		NP_820668.1	24064423
SS01889		hypothetical protein CBU_1724 (NCBI)	Coxiella burnetii		NP_820705.1	24064423
SS01890		hypothetical protein (NCBI)	Brucella melitensis		WP_002963813.1	24064423
SS01891	vipE	Dot/Icm T4SS effector VipE (NCBI)	Legionella pneumophila		WP_010948500.1	24447430
SS01892	wipC	Dot/Icm T4SS effector WipC(NCBI)	Legionella pneumophila		WP_010947915.1	24447430
SS01893		ribosome-associated protein (NCBI)	Legionella pneumophila		WP_010945783.1	24447430
SS01894		hypothetical protein (NCBI)	Legionella pneumophila		WP_010945803.1	24447430
SS01895		hypothetical protein (NCBI)	Legionella pneumophila		WP_010945808.1	24447430
SS01896		hypothetical protein (NCBI)	Legionella pneumophila		WP_010945821.1	24447430
SS01897		hypothetical protein (NCBI)	Legionella pneumophila		WP_010945921.1	24447430
SS01898		ABC transporter permease (NCBI)	Legionella pneumophila		WP_010945931.1	24447430
SS01899		Lpg0257 family Dot/Icm type IV secretion system effector (NCBI)	Legionella pneumophila		WP_010946018.1	24447430
SS01900	legY	Dot/Icm T4SS effector LegY (NCBI)	Legionella pneumophila		WP_010946171.1	24447430
SS01901	legD2	Dot/Icm T4SS effector LegD2 (NCBI)	Legionella pneumophila		WP_010946263.1	24447430
SS01902		lpg0716 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010946453.1	24447430
SS01903	ravH	Dot/Icm T4SS effector RavH (NCBI)	Legionella pneumophila		WP_010946470.1	24447430
SS01904		lpg0796 family Dot/Icm T4SS effector (NCBI)	Legionella pneumophila		WP_010946533.1	24447430
SS01905	legT	Dot/Icm T4SS effector LegT (NCBI)	Legionella pneumophila		WP_010947059.1	24447430
SS01906	legS1	Dot/Icm T4SS effector LegS1 (NCBI)	Legionella pneumophila		WP_010948288.1	24447430
SS01907	legD1	Dot/Icm type IV secretion system effector LegD1 (NCBI)	Legionella pneumophila		WP_010948394.1	24447430
SS01908	legN	Dot/Icm type IV secretion system effector LegN (NCBI)	Legionella pneumophila		WP_010948419.1	24447430
SS01909		IS110-like element IS1111A family transposase (NCBI)	Coxiella burnetii		WP_005772222.1	24447430
SS01910	coxCC15	Dot/Icm T4SS effector CoxCC15 (NCBI)	Coxiella burnetii		WP_012220016.1	24447430
SS01912	ankA	ankyrin repeat domain-containing T4SS effector AnkA (NCBI)	Coxiella burnetii		WP_012220077.1	24447430
SS01913	mceA	Dot/Icm T4SS effector MceA (NCBI)	Coxiella burnetii		WP_012220080.1	24447430
SS01914		hypothetical protein (NCBI)	Coxiella burnetii		WP_012220099.1	24447430
SS01915	ankB	ankyrin repeat domain-containing T4SS effector AnkB (NCBI)	Coxiella burnetii		WP_012220107.1	24447430
SS01916	coxK1	Dot/Icm T4SS effector protein kinase CoxK1 (NCBI)	Coxiella burnetii		WP_005772950.1	24447430
SS01917		CBU_0270 family Dot/Icm type IV secretion system effector (NCBI)	Coxiella burnetii		WP_010957471.1	24447430
SS01918		phosphomannomutase/phosphoglucomutase (NCBI)	Coxiella burnetii		WP_012220155.1	24447430
SS01919	coxCC3	Dot/Icm T4SS effector CoxCC3 (NCBI)	Coxiella burnetii		WP_012220207.1	24447430
SS01920		hypothetical protein (NCBI)	Coxiella burnetii		WP_005771948.1	24447430
SS01921		CBU_0425 family Dot/Icm T4SS effector (NCBI)	Coxiella burnetii		WP_012220212.1	24447430
SS01925	coxCC5	Dot/Icm T4SS effector CoxCC5 (NCBI)	Coxiella burnetii		WP_010957865.1	24447430
SS01926	rimI	ribosomal protein S18-alanine N-acetyltransferase RimI/CoxH2 (NCBI)	Coxiella burnetii		WP_005768924.1	24447430
SS01927	coxCC4	Dot/Icm T4SS effector CoxCC4 (NCBI)	Coxiella burnetii		WP_012220474.1	24447430
SS01929		membrane protein (NCBI)	Coxiella burnetii		WP_012220554.1	24447430
SS01930	bamC	outer membrane protein assembly factor BamC (NCBI)	Coxiella burnetii		WP_012220557.1	24447430
SS01932		protein kinase (NCBI)	Coxiella burnetii		WP_012220629.1	24447430
SS01934	coxDFB4	Dot/Icm type IV secretion system effector CoxDFB4 (NCBI)	Coxiella burnetii		WP_005771746.1	24447430
SS01935		hypothetical protein (NCBI)	Coxiella burnetii		WP_012220693.1	24447430
SS01936	coxCC10	Dot/Icm T4SS effector CoxCC10 (NCBI)	Coxiella burnetii		WP_012220701.1	24447430
SS01937	coxCC11	Dot/Icm T4SS effector CoxCC11 (NCBI)	Coxiella burnetii		WP_010958299.1	24447430
SS01939		Dot/Icm T4SS effector CoxDFB5 (NCBI)	Coxiella burnetii		WP_012220780.1	24447430
SS01940		ankyrin repeat domain-containing protein (NCBI)	Coxiella burnetii		WP_012220782.1	24447430
SS01941	coxH3	Dot/Icm type IV secretion system effector CoxH3 (NCBI)	Coxiella burnetii		WP_005770384.1	24447430
SS01942	coxH4	Dot/Icm T4SS effector CoxH4 (NCBI)	Coxiella burnetii		WP_012220816.1	24447430
SS01943	coxDFB6	Dot/Icm T4SS effector CoxDFB6 (NCBI)	Coxiella burnetii		WP_005772185.1	24447430
SS01944		inorganic phosphate transporter (NCBI)	Coxiella burnetii		WP_012220885.1	24447430
SS01945	coxFIC1	Dot/Icm type IV secretion system effector CoxFIC1 (NCBI)	Coxiella burnetii		WP_012220895.1	24447430
SS01946		cyclic nucleotide-binding domain-containing protein (NCBI)	Ochrobactrum anthropi		WP_012091151.1	24447430
SS01947		gamma carbonic anhydrase family protein (NCBI)	Ochrobactrum anthropi		WP_012091901.1	24447430
SS01950		hypothetical protein (NCBI)	Ochrobactrum anthropi		WP_012093522.1	24447430
SS01951		orf_Bo210 (plasmid) (NCBI)	Agrobacterium tumefaciens		YP_001967606.1	24447430
SS01953		PepSY domain-containing protein (NCBI)	Brucella pinnipedialis		WP_002964730.1	24447430
SS01954		Chain B, Crystal Structure Of Legk4_apo Kinase (NCBI)	Legionella pneumophila		5CLR_B	26419332
SS01955	ralF	RalF (NCBI)	Legionella pneumophila		AAL23711.1	26291822
SS01957	virB11	VirB11 (NCBI)	Bartonella henselae		AFK10355.1	25474545
SS01958	traN	conjugal transfer mating pair stabilization protein TraN (plasmid) (NCBI)	Escherichia coli		NP_862934.1	25195751
SS01959	traK	conjugal transfer protein TraK (plasmid) (NCBI)	Escherichia coli		NP_957603.1	24914183
SS01960	ankG	ankyrin protein, substrate of the Dot/Icm secretion system (NCBI)	Legionella pneumophila		CCD07726.1	24733095
SS01961		CaeA (NCBI)	Mycobacterium tuberculosis		ALB19409.1	23126667
SS02462	Smlt4383	Smlt4383	Stenotrophomonas maltophilia (strain K279a)	B2FKS6	WP_012481484.1	31513674
SS02463	Smlt4012	Smlt4012 (Reference)	Stenotrophomonas maltophilia (strain K279a)	B2FUP9	WP_012481267.1	31513674
SS02464	Smlt3024	Smlt3024 (Reference)	Stenotrophomonas maltophilia (strain K279a)	B2FJJ5	PJL13822.1	31513674
SS02465	Smlt2992	Smlt2992 (Reference)	Stenotrophomonas maltophilia (strain K279a)	B2FJG3	AYZ70607.1	31513674
SS02466	Smlt2990	Smlt2990 (Reference)	Stenotrophomonas maltophilia (strain K279a)	B2FJG1	WP_005410111.1	31513674
SS02467	Smlt0505	Smlt0505 (Reference)	Stenotrophomonas maltophilia (strain K279a)	B2FKX6	CAQ44095.1	31513674
SS02468	Smlt0502	Smlt0502 (Reference)	Stenotrophomonas maltophilia (strain K279a)	B2FKX3	PJL24813.1	31513674
SS02469	Smlt0500	Smlt0500 (Reference)	Stenotrophomonas maltophilia (strain K279a)	B2FKX1	WP_012478977.1	31513674
SS02470	Smlt0332	Smlt0332 (Reference)	Stenotrophomonas maltophilia (strain K279a)	B2FJ05	WP_012478868.1	31513674
SS02471	Smlt0273	Smlt0273 (Reference)	Stenotrophomonas maltophilia (strain K279a)	B2FI89	PJL25731.1	31513674
SS02472	Smlt0193	Smlt0193 (Reference)	Stenotrophomonas maltophilia (strain K279a)	B2FHF9	WP_138970253.1	31513674
SS02473	Smlt0113	Smlt0113 (Reference)	Stenotrophomonas maltophilia (strain K279a)	B2FU71	WP_012478700.1	31513674

T6SS substrate

Top

BastionHub ID	Gene Name	Brief Description	Species	UniProt ID	NCBI ID	PubMed ID
SS01962	vgrG1	Actin cross-linking toxin VgrG1 (UniProt)	Vibrio cholerae	A0A0H3AIG7	WP_000212118.1
SS01963	AHA_1119	Rhs element Vgr protein (UniProt)	Aeromonas hydrophila	A0KHA9	WP_011705045.1	25640659
SS01964	Aave_0030	BPSL0067 family protein (NCBI)	Acidovorax citrulli	A1TI59	WP_011793225.1	22607806
SS01965	Aave_1502	BPSL0067 family protein (NCBI)	Acidovorax citrulli	A1TMA4	WP_011794642.1	22607806
SS01966	Aave_2422	BPSL0067 family protein (NCBI)	Acidovorax citrulli	A1TPV9	WP_011795529.1	22607806
SS01967	Aave_4757	hypothetical protein Aave_4757 (NCBI)	Acidovorax citrulli	A1TWF0	ABM35288.1	22607806
SS01968	BURPS668_0080	BPSL0067 family protein (NCBI)	Burkholderia pseudomallei	A3N464	WP_004553735.1	22607806
SS01969	ESA_03935	type VI secretion system amidase effector protein Tae4 (NCBI)	Cronobacter sakazakii	A7MQ14	WP_012126156.1	22607806
SS01970	CKO_00829	NLPC_P60 domain-containing protein (UniProt)	Citrobacter koseri	A8AER8	ABV11981.1	22607806
SS01971	CKO_01385	hypothetical protein CKO_01385 (NCBI)	Citrobacter koseri	A8AGA8	ABV12521.1	22607806
SS01972	Daci_3854	Putative cytoplasmic protein (UniProt, NCBI)	Delftia acidovorans	A9BLK0	ABX36485.1	22607806
SS01973	Daci_4291	Putative cytoplasmic protein (UniProt, NCBI)	Delftia acidovorans	A9BLY3	ABX36922.1	22607806
SS01974	ABSDF_p20032	hypothetical protein ABSDF_p20032 (NCBI)	Acinetobacter baumannii	B0VVE2	CAP02972.1	22607806
SS01975	BamMC406_0673	BPSL0067 family protein (NCBI)	Burkholderia ambifaria	B1YTK4	WP_012363155.1	22607806
SS01976	Bphyt_0467	Putative cytoplasmic protein (UniProt)	Paraburkholderia phytofirmans	B2SWU8	WP_012431535.1	22607806
SS01977	Bphyt_5187	conserved hypothetical protein (NCBI)	Paraburkholderia phytofirmans	B2TCX2	ACD19546.1	22607806
SS01978	ETA_06210	type VI secretion system amidase effector protein Tae4 (NCBI)	Erwinia tasmaniensis	B2VH84	WP_012440370.1	22607806
SS01979	Rpic12D_3260	Putative cytoplasmic protein (UniProt)	Ralstonia pickettii	C6BHF2	WP_015855995.1	22607806
SS01980	Ctu_30570	hypothetical protein CTU_30570 (NCBI)	Cronobacter turicensis	C9XXJ5	CBA32722.1	22607806
SS01981	Ctu_32660	hypothetical protein CTU_32660 (NCBI)	Cronobacter turicensis	C9XYW6	CBA33145.1	22607806
SS01982	Ctu_33040	hypothetical protein CTU_33040 (NCBI)	Cronobacter turicensis	C9XZ04	CBA33222.1	22607806
SS01983	ENTCAN_06548	hypothetical protein ENTCAN_06548 (NCBI)	Enterobacter cancerogenus	D2ZDL2	EFC56680.1	22607806
SS01984	HMPREF0758_3166	type VI secretion system amidase effector protein Tae4 (NCBI)	Serratia odorifera DSM 4582.	D4E4R6	WP_004961376.1	22607806
SS01985	EAMY_3018	type VI secretion system amidase effector protein Tae4 (NCBI)	Erwinia amylovora	D4I0Q7	WP_004159897.1	22607806
SS01986	BC1002_0678	BPSL0067 family protein (NCBI)	Burkholderia sp.	D5WCZ6	WP_013088666.1	22607806
SS01987	ECEG_03250	type VI secretion system amidase effector protein Tae4 (NCBI)	Escherichia coli	D6J6Z7	WP_000533467.1	22607806
SS01989	vgrGA	Putative type VI secretion system protein VgrGA (UniProt)	Dickeya dadantii	E0SAL0	WP_013316544.1
SS01990	vgrGB	Putative type VI secretion system protein VgrGB (UniProt)	Dickeya dadantii	E0SIS4	WP_013318571.1
SS01991	GM18_4341	hypothetical protein GM18_4341 (NCBI)	Geobacter sp.	E8WJ67	ADW15752.1	22607806
SS01992	Acav_4746	hypothetical protein Acav_4746 (NCBI)	Acidovorax avenae	F0QCN5	ADX48624.1	22607806
SS01993	HMPREF9086_2717	type VI secretion system amidase effector protein Tae4 (NCBI)	Enterobacter hormaechei	F5RYK9	WP_006810953.1	22607806
SS01994	DelCs14_2971	Putative cytoplasmic protein (UniProt)	Delftia sp.	F6AQK3	MPT03606.1	22607806
SS01996	TASI_0128	hypothetical protein TASI_0128 (NCBI)	Taylorella asinigenitalis	G4QDA2	AEP35919.1	22607806
SS01997	sciK	Hcp1 family type VI secretion system effector (UniProt)	Salmonella enterica	H9L4J2		25640659
SS01998	VC_1415	Hcp protein (UniProt)	Vibrio cholerae	H9L4Q3	WP_001142947.1	25640659
SS01999	Bxe_B1040	Uncharacterized protein (UniProt)	Burkholderia xenovorans	Q13LX5		22607806
SS02000	Bxe_A2093	Uncharacterized protein (UniProt)	Burkholderia xenovorans	Q13YG4		22607806
SS02001	BTH_I0068	BPSL0067 family protein (NCBI)	Burkholderia thailandensis	Q2T2K7	WP_009902034.1	22607806
SS02006	PFL_5498	Uncharacterized protein (UniProt)	Pseudomonas fluorescens	Q4K5B7		22607806
SS02007	Psyr_4040	Putative cytoplasmic protein (UniProt)	Pseudomonas syringae	Q4ZP52	WP_011268807.1	22607806
SS02008	STY2606	NlpC/P60 enzyme (UniProt)	Salmonella enterica	Q8Z4Z6	pir\|AE0803\|	22607806
SS02009	STY0300	Uncharacterised protein (UniProt)	Salmonella enterica	Q8Z969		22607806
SS02011	STM0277	type VI secretion system amidase effector protein Tae4 (NCBI)	Salmonella enterica	Q93IS4	WP_001081550.1	22607806
SS02012	tse1	Peptidoglycan amidase Tse1 (UniProt)	Pseudomonas aeruginosa	Q9I2Q1	WP_003088027.1	25640659
SS02013	vgrG1	Actin cross-linking toxin VgrG1 (UniProt)	Vibrio cholerae	Q9KS45	MDSLDQCIVNACKNSWDKSYLAGTPNKDNCSGFVQSVAAELGVPMPRGNANAMVDGLEQSWTKLASGAEAAQKAAQGFLVIAGLKGRTYGHVAVVISGPL
SS02014		Hcp family type VI secretion system effector (NCBI)	Burkholderia mallei		WP_004200972.1	25640659
SS02015		hypothetical protein PA2702 (NCBI)	Pseudomonas aeruginosa		AAG06090.1	25640659
SS02016		hypothetical protein PA3484 (NCBI)	Pseudomonas aeruginosa PAO1		AAG06872.1	25640659
SS02017		conserved hypothetical protein (NCBI)	Helicobacter hepaticus		AAP76840.1	25640659
SS02018	hcp1	Protein hcp1 (UniProt)	Pseudomonas aeruginosa	Q9I747	WP_003083670.1
SS02019		hypothetical protein HH_0242 (NCBI)	Helicobacter hepaticus		AAP76839.1	25640659
SS02020		hypothetical protein BMAA0729 (NCBI)	Burkholderia mallei		AAY59304.1	25640659
SS02021		hypothetical protein (NCBI)	Vibrio cholerae		WP_000070352.1	25640659
SS02022	tagO	type VI secretion system-associated protein TagO (NCBI)	Vibrio cholerae		WP_001882968.1	25640659
SS02023	evpP	EvpP (NCBI)	Edwardsiella tarda		ACR24239.1	25640659
SS02024		conserved hypothetical protein (NCBI)	Burkholderia thailandensis		ABC38716.1	25640659
SS02025		Rhs element Vgr protein, putative (NCBI)	Burkholderia thailandensis		ABC34634.1	25640659
SS02026		Rhs element Vgr protein, putative (NCBI)	Burkholderia thailandensis		ABC36513.1	25640659
SS02027		Rhs element Vgr protein, putative (NCBI)	Burkholderia thailandensis		ABC38017.1	25640659
SS02028		Rhs element Vgr protein, putative (NCBI)	Burkholderia thailandensis		ABC36370.1	25640659
SS02029		Rhs element Vgr protein (NCBI)	Burkholderia thailandensis		ABC36714.1	25640659
SS02030		conserved hypothetical protein (NCBI)	Burkholderia thailandensis		ABC39416.1	25640659
SS02031		antifungal protein precursor, putative (NCBI)	Burkholderia thailandensis		ABC34803.1	25640659
SS02032		conserved hypothetical protein (NCBI)	Burkholderia thailandensis		ABC38949.1	25640659
SS02033		conserved hypothetical protein (NCBI)	Burkholderia thailandensis		ABC37431.1	25640659
SS02034		conserved hypothetical protein (NCBI)	Burkholderia thailandensis		ABC33998.1	25640659
SS02035		hypothetical protein BTH_I2691 (NCBI)	Burkholderia thailandensis		ABC38088.1	25640659
SS02036		Hcp family type VI secretion system effector (NCBI)	Pseudomonas syringae		WP_011105495.1	25640659
SS02037		hypothetical protein PA2685 (NCBI)	Pseudomonas aeruginosa		NP_251375.1	25640659
SS02038	rbsB	ribose ABC transporter substrate-binding protein RbsB (NCBI)	Bacillus amyloliquefaciens		ABS75643.1	25640659
SS02039	evpC	EvpC (NCBI)	Edwardsiella tarda		AAR83929.1	25640659
SS02040	tssI	type VI secretion system tip protein VgrG (NCBI)	Vibrio cholerae		WP_000113295.1	25640659
SS02041		vgrG protein (NCBI)	Vibrio cholerae		AAF94573.1	25640659
SS02042		hypothetical protein (NCBI)	Francisella tularensis		WP_003016192.1	25640659
SS02043		hypothetical protein (NCBI)	Francisella tularensis		WP_003016179.1	25640659
SS02044		putative type VI secretion protein (NCBI)	Escherichia coli		CBG37385.1	25640659
SS02045		conserved hypothetical protein (NCBI)	Francisella tularensis		CAJ78559.1	25640659
SS02046		putative type VI secretion protein (NCBI)	Escherichia coli		CBG37351.1	25640659
SS02047		type VI secretion system tube protein Hcp (NCBI)	Agrobacterium tumefaciens		WP_003504561.1	25640659
SS02048		conserved hypothetical protein (NCBI)	Pectobacterium atrosepticum		CAG76327.1	25640659
SS02049		conserved hypothetical protein (NCBI)	Pectobacterium atrosepticum		CAG76328.1	25640659
SS02050	evpI	EvpI (NCBI)	Edwardsiella tarda		ABW69081.1	25640659
SS02051		protein of unknown function DUF796 (NCBI)	Pseudomonas fluorescens		ACA69830.1	25640659
SS02052		Hcp-2 hemolysin-coregulated protein (NCBI)	Aeromonas hydrophila		ABG57132.1	25640659
SS02053		type VI secretion system effector, Hcp1 family (NCBI)	Pectobacterium carotovorum		ACT11497.1	25640659
SS02054		type VI secretion system effector, Hcp1 family (NCBI)	Dickeya chrysanthemi		ACT07649.1	25640659
SS02055		type VI secretion system effector, Hcp1 family (NCBI)	Pectobacterium wasabiae		ACX85929.1	25640659
SS02056		protein of unknown function (NCBI)	Francisella tularensis		ABK90193.1	25640659
SS02057		conserved hypothetical protein (NCBI)	Francisella tularensis		ABK90188.1	25640659
SS02058	vgrG2	VgrG-2 protein (NCBI)	Aeromonas hydrophila		ABG57133.1	25640659
SS02059	vgrG3	VgrG-3 protein (NCBI)	Aeromonas hydrophila		ABG57151.1	25640659
SS02060		uncharacterized hemolysin-coregulated protein (NCBI)	Vibrio alginolyticus		ACN89305.1	25640659
SS02061		conserved hypothetical protein (NCBI)	Pseudomonas protegens		AAY94704.1	25640659
SS02062	cts1H	Hcp family T6SS protein Cts1H (NCBI)	Citrobacter rodentium		CBG89517.1	25640659
SS02063		type VI secretion system Vgr family protein (NCBI)	Pseudomonas fluorescens		ACA69825.1	25640659
SS02064		lipase (NCBI)	Vibrio cholerae		WP_000376836.1	25640659
SS02065		hypothetical protein A1S_1296 (NCBI)	Acinetobacter baumannii		ABO11724.1	25640659
SS02066	pldA	phospholipase D (NCBI)	Pseudomonas aeruginosa		AAG06875.1	25640659
SS02067		type VI secretion system amidase effector protein Tae4 (NCBI)	Agrobacterium tumefaciens		WP_006315890.1	25640659
SS02068		conserved hypothetical protein (NCBI)	Pseudomonas protegens		AAY92307.1	25640659
SS02069	idsD	IdsD (NCBI)	Proteus mirabilis		AGS61453.1	25640659
SS02070	idsA	IdsA (NCBI)	Proteus mirabilis		AGS61450.1	25640659
SS02071	idsB	IdsB (NCBI)	Proteus mirabilis		AGS61451.1	25640659
SS02072	idrB	IdrB (NCBI)	Proteus mirabilis		AGS59319.1	25640659
SS02073		hypothetical protein PA0093 (NCBI)	Pseudomonas aeruginosa		NP_248783.1	25640659
SS02074		hypothetical protein PA2684 (NCBI)	Pseudomonas aeruginosa		NP_251374.1	25640659
SS02075		hypothetical protein PA2774 (NCBI)	Pseudomonas aeruginosa		NP_251464.1	25640659
SS02076		hypothetical protein PA5089 (NCBI)	Pseudomonas aeruginosa		NP_253776.1	25640659
SS02077		S-type pyocin domain-containing protein (NCBI)	Vibrio parahaemolyticus		WP_011106455.1	25640659
SS02078		hypothetical protein (NCBI)	Vibrio parahaemolyticus		WP_011105821.1	25640659
SS02079		DUF4150 domain-containing protein (NCBI)	Vibrio parahaemolyticus		WP_005493834.1	25640659
SS02080		hypothetical protein V12G01_02265 (NCBI)	Vibrio alginolyticus		EAS77247.1	25640659
SS02081		DUF4150 domain-containing protein (NCBI)	Agrobacterium tumefaciens		WP_010973208.1	25640659
SS02082		hypothetical protein (NCBI)	Agrobacterium tumefaciens		WP_010973767.1	25640659
SS02083		hypothetical protein (NCBI)	Flavobacterium johnsoniae		WP_012025242.1	25640659
SS02084		hypothetical protein (NCBI)	Flavobacterium johnsoniae		WP_012025259.1	25640659
SS02085		type IV secretion protein Rhs (NCBI)	Flavobacterium johnsoniae		WP_012025245.1	25640659
SS02086		hypothetical protein (NCBI)	Flavobacterium johnsoniae		WP_012025247.1	25640659
SS02087		RHS domain-containing protein (NCBI)	Enterobacter cloacae		WP_013096205.1	25640659
SS02088		PAAR domain-containing protein (NCBI)	Enterobacter cloacae		WP_013097665.1	25640659
SS02089	tssI	type VI secretion system tip protein VgrG (NCBI)	Burkholderia thailandensis		WP_009896187.1	25640659
SS02090		Hcp family type VI secretion system effector (NCBI)	Burkholderia thailandensis		WP_009896195.1	25640659
SS02091		type VI secretion system tube protein Hcp (NCBI)	Acinetobacter baumannii		WP_000653195.1	25640659
SS02092		type VI secretion system tube protein Hcp (NCBI)	Acinetobacter sp. ADP1		WP_004929007.1	25640659
SS02098		conserved protein of unknown function, aromatic compound dioxygenase domain (plasmid) (NCBI)	Ralstonia solanacearum		YP_003748701.1	23552891
SS02099		DUF2235 domain-containing protein (NCBI)	Burkholderia thailandensis		WP_011402454.1	23552891
SS02101		DUF2235 domain-containing protein (NCBI)	Serratia proteamaculans		WP_012006220.1	23552891
SS02102		DUF2235 domain-containing protein (NCBI)	Klebsiella pneumoniae		WP_004224376.1	23552891
SS02103		DUF2235 domain-containing protein (NCBI)	Enterobacter aerogenes		WP_015705640.1	23552891
SS02104		hypothetical protein PA3290 (NCBI)	Pseudomonas aeruginosa		NP_251980.1	23552891
SS02105		DUF2235 domain-containing protein (NCBI)	Chromobacterium violaceum		WP_011133567.1	23552891
SS02106	pdl1	Pdl1 (NCBI)	Photorhabdus luminescens		AAL18491.1	23552891
SS02107		lipase family protein (NCBI)	Xenorhabdus bovienii		WP_012988017.1	23552891
SS02108		lipase family protein (NCBI)	Proteus mirabilis		WP_012367965.1	23552891
SS02110		lipase (NCBI)	Pseudomonas syringae		WP_011104583.1	23552891
SS02111		lipase family protein (NCBI)	Pseudomonas fluorescens		WP_011331864.1	23552891
SS02112		lipase (NCBI)	Pseudomonas entomophila		WP_011536446.1	23552891
SS02114		DUF3274 domain-containing protein (NCBI)	Azoarcus sp.		WP_011767193.1	23552891
SS02115		DUF3274 domain-containing protein (NCBI)	Pseudomonas syringae		WP_011105290.1	23552891
SS02116		DUF3274 domain-containing protein (NCBI)	Xanthomonas oryzae		WP_012445925.1	23552891
SS02118		hypothetical protein PA0260 (NCBI)	Pseudomonas aeruginosa		NP_248951.1	23552891
SS02119		DUF3274 domain-containing protein (NCBI)	Enterobacter cloacae		WP_014882523.1	23552891
SS02120		hypothetical protein (NCBI)	Escherichia coli		WP_000106189.1	23552891
SS02121		hypothetical protein (NCBI)	Erwinia billingiae		WP_013203950.1	23552891
SS02122		conserved protein of unknown function, hydrolase domain (plasmid) (NCBI)	Ralstonia solanacearum		YP_003748324.1	23552891
SS02123		hypothetical protein PA1510 (NCBI)	Pseudomonas aeruginosa		NP_250201.1	23552891
SS02124		alpha/beta hydrolase (NCBI)	Burkholderia cenocepacia		WP_011695165.1	23552891
SS02125		acetyltransferase (NCBI)	Erwinia billingiae		WP_013200451.1	23552891
SS02126		PGAP1-like protein (NCBI)	Enterobacter cloacae		CBK84496.1	23552891
SS02127		hypothetical protein (NCBI)	Escherichia coli		WP_000204766.1	23552891
SS02128		hypothetical protein (NCBI)	Xanthomonas oryzae		WP_014504343.1	23552891
SS02129		putative phospholipase protein (plasmid) (NCBI)	Ralstonia solanacearum		YP_003747859.1	23552891
SS02130		phospholipase (NCBI)	Chromobacterium violaceum		WP_011134789.1	23552891
SS02131		phospholipase (NCBI)	Aggregatibacter aphrophilus		WP_012771255.1	23552891
SS02132		phospholipase D (NCBI)	Pseudomonas aeruginosa		NP_252177.1	23552891
SS02133		phospholipase (NCBI)	Cupriavidus taiwanensis		WP_012355863.1	23552891
SS02134		Hcp3 (Reference); type VI secretion system effector Hcp3 (NCBI)	Pseudomonas fluorescens		EIK66646.1	26460929;25663006
SS02135	evpC	type VI secretion system protein EvpC (NCBI)	Edwardsiella tarda		AIJ06941.1	25663006
SS02136	evpP	EvpP (Reference, NCBI)	Edwardsiella tarda		ACR24234.1	25042941;19563898
SS02138	vgrG3	VgrG3(Reference); type VI secretion protein VgrG3 (NCBI)	Pseudomonas fluorescens		EJL01728.1	25042941;24331463
SS02139		Chain F, Crystal Structure Of The Type Vi Semet Effector-immunity Complex Tae3- Tai3 From Ralstonia Pickettii (NCBI)	Pseudomonas fluorescens		4HZB_F	23730712
SS02140		Tse1 (Reference); Chain A, Crystal Structure Of Type Effector Tse1 From Pseudomonas Aeruginousa (NCBI)	Pseudomonas fluorescens		4F0V_A	25042941;23730712
SS02141		Tae4 (Reference); Chain A, Crystal Structure Of The Type Vi Effector Tae4 From Enterobacter Cloacae (NCBI)	Pseudomonas fluorescens		4HFL_A	25042941;23730712
SS02142	hcp	Hcp (NCBI)	Desulfobacterium autotrophicum		ACN17117.1	26093203
SS02433	HMPREF9534_04876	Hcp (Reference); Type VI secretion system effector, Hcp1 family (UniProt, NCBI)	Escherichia coli	D7ZKQ6	ADX52261.1	26093203
SS02434	BCAM1857	TecA (Reference); hypothetical protein BURCENK562V_C3992 (NCBI)	Burkholderia cenocepacia	B4EMB9	EPZ89291.1	27133449
SS02435	PA0262	VgrG2b (Reference); type VI secretion system tip protein VgrG (NCBI)	Pseudomonas aeruginosa	Q9I6M7	WP_003147109.1	26037124
SS02436	katN	KatN (Reference); Non-heme catalase KatN (UniProt)	Pseudomonas aeruginosa	Q9I1T0	AGV61017.1	28288207
SS02437	EC042_4534	Tle1 (Reference); T6SS effector phospholipase Tle1-EAEC (NCBI)	Escherichia coli	D3GUW5	WP_000170556.1	26714038
SS02438	rhsB	RhsB (Reference); Protein RhsB (UniProt)	Escherichia coli	P16917	WP_000015298.1	23572593
SS02439	hcpA_1	Hcp-ET1 (Reference); Hcp1 family type VI secretion system effector (UniProt, NCBI)	Escherichia coli	A0A2Y0FSQ5	ELG48174.1	28060574
SS02440	hcp	Hcp-ET2 (Reference); Hcp1 family type VI secretion system effector (UniProt)	Escherichia coli	A0A3K3ND08	ELH07638.1	28060574
SS02441	A464_149	Hcp-ET3 (1) (Reference); VgrG protein (UniProt)	Salmonella bongori	S5N4I1	AGR57335.1	28060574
SS02442		Hcp-ET3 (4) (Reference); type VI secretion system effector, Hcp1 family protein (NCBI)	Citrobacter freundii		KEL77525.1	28060574
SS02443	HMPREF9530_03376	Hcp-ET3+4 (Reference); Type VI secretion system effector, Hcp1 family (UniProt, NCBI)	Escherichia coli	D8A9Z9	EFK20023.1	28060574
SS02444	hcp	Hcp-ET5 (Reference); Type VI secretion system tube protein Hcp (UniProt)	Salmonella enterica	A0A3J5XDL1	EHY67871.1	28060574
SS02445	hcp	Hcp1 family type VI secretion system effector (UniProt, NCBI)	Escherichia coli	A0A1X0YID2	ETJ19745.1	28060574
SS02446	VPR01S_11_01580	MIX-effector1 (Reference); hypothetical protein VPR01S_11_01580 (NCBI)	Vibrio proteolyticus	U3BEL6	GAD68164.1	27066305
SS02447	VPR01S_11_01570	MIX-effector2 (Reference); hypothetical protein VPR01S_11_01570 (NCBI)	Vibrio proteolyticus	U3BNK6	GAD68163.1	27066305
SS02448	BTH_II1883	TseM (Reference); conserved hypothetical protein (NCBI)	Burkholderia thailandensis	Q2T422	WP_011401419.1	28242693
SS02449	PA2374	TseF (Reference); hypothetical protein PA2374 (NCBI)	Pseudomonas aeruginosa	Q9I1A5	NP_251064.1	28348410