Browse
All five types of bacterial secreted substrate proteins are listed below. Users can directly click the BastionHub ID for quick access to the corresponding entry.
T1SS substrate
BastionHub ID | Gene Name | Brief Description
![]() |
Species | UniProt ID | NCBI ID | PubMed ID |
---|---|---|---|---|---|---|
SS02226 | mcbA | McbA (Reference); Bacteriocin microcin B17 (UniProt, NCBI) | Escherichia coli | P05834 | EAA5695944.1 | 8302219 |
SS02227 | Serralysin (UniProt) | Serratia marcescens | P07268 | WP_033644999.1 | 3253732 | |
SS02228 | hlyA | HlyA (Reference); hemolysin A (NCBI) | Escherichia coli | P08715 | AAA98233.1 | 23541474 |
SS02229 | lktA | LktA (Reference); leukotoxin A (NCBI) | Mannheimia haemolytica | P0C081 | AFI60251.1 | 20528947 |
SS02230 | Hemolysin, heat labile (UniProt, NCBI) | Grimontia hollisae | P14711 | P14711.1 | 3253732 | |
SS02231 | cya | CyaA (Reference); bifunctional adenylate cyclase toxin/hemolysin CyaA (NCBI) | Bordetella pertussis | J7QLC0 | WP_010929995.1 | 20528947 |
SS02232 | apxIIA | ApxIIA (Reference); RTX-II toxin determinant A (UniProt) | Actinobacillus pleuropneumoniae | P15377 | BAV25207.1 | 20528947 |
SS02233 | nodO | NodO (Reference); Nodulation protein O (UniProt) | Rhizobium leguminosarum | P15728 | AAA26341.1 | 20528947 |
SS02234 | prtB | PrtB (Reference); Serralysin B (UniProt) | Dickeya chrysanthemi | P16316 | AAA24861.1 | 20528947 |
SS02235 | prtC | PrtC (Reference); Serralysin C (UniProt) | Dickeya chrysanthemi | P16317 | 1K7G_A | 20528947 |
SS02236 | cvaC | Colicin-V (UniProt) | Escherichia coli | P22522 | YP_002527505.1 | |
SS02237 | Lipase (UniProt) | Pseudomonas fluorescens | P26504 | BAA02012.1 | 3253732 | |
SS02238 | sapA | S-layer protein (UniProt) | Campylobacter fetus | P35827 | AAO64227.1 | 9851986 |
SS02239 | frpA | FrpA (Reference); Iron-regulated protein FrpA (UniProt, NCBI) | Neisseria meningitidis | P55126 | P55126.1 | 20528947 |
SS02240 | frpC | Iron-regulated protein FrpC (UniProt, NCBI) | Neisseria meningitidis | P55127 | P55127.1 | 11500424 |
SS02241 | apxIA | ApxIA (Reference); RTX-I toxin determinant A from serotypes 1/9 (UniProt) | Actinobacillus pleuropneumoniae | P55128 | P55128.1 | 20528947 |
SS02242 | apxIIIA | ApxIIIA (Reference); RTX-III toxin determinant A from serotype 2 (UniProt) | Actinobacillus pleuropneumoniae | P55130 | P55130.1 | 20528947 |
SS02243 | mchB | Microcin H47 (UniProt, NCBI) | Escherichia coli | P62530 | AOM43078.1 | 11181394 |
SS02244 | prtA | Protease PrtA (NCBI) | Photorhabdus sp. | P82115 | P82115.2 | 15049334;12777498 |
SS02245 | aprA | AprA (Reference); serralysin family metalloprotease AprA (NCBI) | Pseudomonas aeruginosa | Q03023 | WP_003082542.1 | 20528947 |
SS02246 | prtG | PrtG (Reference); Serralysin G (UniProt) | Dickeya chrysanthemi | Q07162 | CAA50501.1 | 20528947 |
SS02247 | prtA | PrtA (Reference); Serralysin A (UniProt) | Dickeya chrysanthemi | Q07295 | CAA49611.1 | 20528947 |
SS02248 | zapA | ZapA (Reference); Serralysin (UniProt) | Proteus mirabilis | Q11137 | Q11137.1 | 20528947 |
SS02249 | algE4 | Mannuronan C5-epimerase AlgE4 (UniProt) | Azotobacter vinelandii | Q44493 | Q44493.1 | 16855245 |
SS02250 | mtfS | Microcin-24 (UniProt) | Escherichia coli | Q46971 | Q46971.1 | |
SS02251 | hasA | HasA (Reference); Hemophore HasA (UniProt) | Serratia marcescens | Q54450 | 1B2V_A | 20528947;15546664 |
SS02252 | paxA | PaxA (Reference); Exotoxin PaxA (UniProt, NCBI) | Pasteurella aerogenes | Q9RCG8 | Q9RCG8.1 | 20528947 |
SS02253 | mcjA | Microcin J25 (UniProt) | Escherichia coli | Q9X2V7 | WP_001513516.1 | 15866933 |
SS02254 | mceA | Microcin E492 (UniProt, NCBI) | Klebsiella pneumoniae | Q9Z4N4 | Q9Z4N4.2 | 16569859 |
SS02255 | algE7 | Alginate lyase 7 (UniProt) | Azotobacter vinelandii | Q9ZFG9 | WP_012703560.1 | 16855245 |
SS02256 | prtA | Protease PrtA (UniProt, NCBI) | Pseudomonas fluorescens | Q9ZG96 | AAD09851.1 | 10074078 |
SS02257 | tliA | Thermostable lipase TliA (UniProt) | Pseudomonas fluorescens | Q9ZG91 | AAD09856.1 | 17555839;20528947 |
SS02258 | XF_0668 | Hemolysin-type calcium binding protein (UniProt, NCBI) | Xylella fastidiosa | Q9PFI9 | AAF83478.1 | 17427810 |
SS02259 | XF_1011 | Hemolysin-type calcium binding protein (UniProt, NCBI) | Xylella fastidiosa | Q9PEL7 | AAF83821.1 | 17427810 |
SS02260 | XF_2407 | Bacteriocin (UniProt) | Xylella fastidiosa | Q9PAT8 | WP_155114999.1 | 17427810 |
SS02261 | XF_2759 | Hemolysin-type calcium binding protein (UniProt) | Xylella fastidiosa | Q9P9W1 | AAF85544.1 | 17427810 |
SS02262 | eprC | Extracellular metalloprotease EprC (UniProt, NCBI) | Dickeya chrysanthemi | Q8GN31 | AAN33118.1 | |
SS02263 | eprB | EprB (UniProt, NCBI) | Dickeya chrysanthemi | Q5D1L3 | AAX13994.1 | |
SS02264 | aprAPF33 | Alkaline protease (UniProt) | Pseudomonas fluorescens | Q9ZNJ1 | QJI37777.1 | 10524213 |
SS02265 | mll1028 | Rhizobiocin RzcA (UniProt, NCBI) | Mesorhizobium loti | Q98LG7 | BAB48496.1 | 15044436 |
SS02266 | mll2585 | Endo-1,3-1,4-beta-glycanase (UniProt) | Mesorhizobium loti | Q98I38 | WP_010911029.1 | |
SS02267 | mll6750 | Mll6750 protein (UniProt) | Mesorhizobium loti | Q988G6 | WP_010914294.1 | |
SS02268 | hylA | Hemolysin (UniProt) | Aquifex aeolicus | O67179 | WP_010880680.1 | |
SS02269 | rtxA | VcRtxA (Reference); RTX toxin RtxA (NCBI) | Vibrio cholerae | Q9KS12 | AAF94608.1 | 20528947 |
SS02270 | VC_A0849 | hypothetical protein VC_A0849 (NCBI) | Vibrio cholerae | Q9KL97 | AAF96747.1 | |
SS02271 | PA1245 | hypothetical protein PA1245 (NCBI) | Pseudomonas aeruginosa | G3XCU0 | NP_249936.1 | 20947426 |
SS02272 | PA1874 | BapA prefix-like domain-containing protein (NCBI) | Pseudomonas aeruginosa | Q9I2M3 | WP_003147473.1 | |
SS02273 | NMA1625 | Putative RTX family exoprotein (UniProt) | Neisseria meningitidis | A0A0U1RJD8 | WP_002246250.1 | 17133369 |
SS02274 | SY94_3563 | Endo-beta-1,3-glucanas (UniProt) | Rhizobium radiobacter | A0A083ZK36 | WP_010973145.1 | |
SS02275 | SMc01182 | Hypothetical protein SM2011_c01182 (NCBI) | Sinorhizobium meliloti | Q92KC8 | AGG74195.1 | |
SS02276 | SMc00286 | Calcium-binding protein (UniProt, NCBI) | Sinorhizobium meliloti | Q92KB8 | WP_010969418.1 | |
SS02277 | SMc04171 | SMc04171 (Reference); Hemolysin-type calcium-binding protein (UniProt, NCBI) | Sinorhizobium meliloti | Q92NZ9 | AGG74589.1 | |
SS02278 | SMc04206 | Putative hemolysin-type calcium-binding protein (UniProt, NCBI) | Sinorhizobium meliloti | Q92K62 | AGG74624.1 | 11481430 |
SS02279 | SMc03108 | Calcium-binding protein (UniProt, NCBI) | Sinorhizobium meliloti | Q92LP8 | WP_010970335.1 | |
SS02280 | YPO3973 | Metalloprotease (UniProt) | Yersinia pestis | A0A384L523 | WP_002228165.1 | |
SS02281 | sapA | Secreted protease sapA (UniProt) | Caulobacter vibrioides | A0A0H3C6K3 | ATC27586.1 | 22588222 |
SS02282 | rsaA | RsaA (Reference); S-layer protein RsaA (NCBI) | Caulobacter vibrioides | P35828 | WP_024265658.1 | 22588222;20528947 |
SS02283 | CC_2075 | hypothetical protein CC_2075 (NCBI) | Caulobacter vibrioides | Q9A6L8 | AAK24046.1 | |
SS02284 | CC_2610 | Calcium-binding protein (UniProt) | Caulobacter vibrioides | Q9A554 | YP_002518066.2 | |
SS02285 | SMa0034 | Serralysin-like metalloprotease (UniProt) | Sinorhizobium meliloti | Q931C8 | WP_010967016.1 | |
SS02286 | eglC | Endo-1,3-1,4-beta-glycanase EglC (UniProt) | Sinorhizobium meliloti | Q9Z3Q2 | Q9Z3Q2.2 | |
SS02287 | SMa2111 | hypothetical protein SMa2111 (NCBI) | Sinorhizobium meliloti | Q92XT9 | AAK65809.2 | |
SS02288 | SM_b20079 | SMb20079 (Reference); Probable type I secretion target repeat protein (UniProt) | Sinorhizobium meliloti | Q92X83 | ASP61663.1 | |
SS02289 | SM_b20829 | Putative secreted calcium-binding protein (UniProt, NCBI) | Sinorhizobium meliloti | Q92VX5 | AGG71584.1 | |
SS02290 | SM_b21229 | Putative calcium-binding exported protein (UniProt, NCBI) | Sinorhizobium meliloti | Q92VH1 | WP_010975596.1 | |
SS02291 | wgeA | Putative Ca2+-binding protein WgeA (Formerly ExpE1) (UniProt) | Sinorhizobium meliloti | Q7ANQ3 | 18533835 | |
SS02292 | SM_b21543 | Putative hemolysin-adenlyate cyclase protein (UniProt) | Sinorhizobium meliloti | Q92UV3 | WP_010975828.1 | 19395488 |
SS02293 | exsH | Endo-1,3-1,4-beta-glycanase ExsH (UniProt, NCBI) | Sinorhizobium meliloti | O33680 | WP_010975894.1 | 18533835 |
SS02294 | frpC | Iron-regulated protein (UniProt, NCBI) | Synechocystis sp. | P73019 | BAL28210.1 | 30394639;29678468 |
SS02295 | slr1403 | Slr1403 protein (UniProt) | Synechocystis sp. | P73590 | WP_010872264.1 | |
SS02296 | sll1951 | S-layer protein (UniProt) | Synechocystis sp. | P73817 | BAL29042.1 | 16672608 |
SS02297 | sll0723 | Sll0723 protein (UniProt) | Synechocystis sp. | P74647 | WP_010874244.1 | 29678468 |
SS02298 | sll0721 | Leukotoxin LtA (UniProt, NCBI) | Synechocystis sp. | P74649 | AGF53314.1 | 25239498 |
SS02299 | all0274 | All0274 protein (UniProt) | Nostoc sp. | Q8Z029 | WP_010994451.1 | |
SS02300 | alr0276 | Alr0276 protein (UniProt) | Nostoc sp. | Q8Z027 | WP_010994453.1 | |
SS02301 | alr0290 | Alr0290 protein (UniProt) | Nostoc sp. | Q8Z013 | WP_010994467.1 | |
SS02302 | all0364 | All0364 protein (UniProt) | Nostoc sp. | Q8YZU3 | WP_010994540.1 | |
SS02303 | alr0791 | Outer membrane secretion protein (UniProt, NCBI) | Nostoc sp. | Q8YYQ5 | BAB72748.1 | |
SS02304 | alr1403 | Alr1403 protein (UniProt) | Nostoc sp. | Q8YX15 | BAB73360.1 | |
SS02305 | all2654 | All2654 protein (UniProt) | Nostoc sp. | Q8YTQ9 | WP_010996810.1 | |
SS02306 | all2655 | All2655 protein (UniProt) | Nostoc sp. | Q8YTQ8 | BAB74354.1 | |
SS02307 | all2793 | All2793 protein (UniProt) | Nostoc sp. | Q8YTC9 | BAB74492.1 | |
SS02308 | all3346 | All3346 protein (UniProt) | Nostoc sp. | Q8YRU7 | WP_010997497.1 | |
SS02309 | alr3659 | Alr3659 protein (UniProt) | Nostoc sp. | Q8YR01 | WP_010997803.1 | |
SS02310 | alr4072 | Alr4072 protein (UniProt) | Nostoc sp. | Q8YPW8 | WP_010998212.1 | |
SS02311 | alr4238 | Alr4238 protein (UniProt) | Nostoc sp. | Q8YPF6 | BAB75937.1 | |
SS02312 | all7128 | All7128 protein (UniProt) | Nostoc sp. | Q8YL10 | WP_010999685.1 | |
SS02313 | alr7304 | Alr7304 protein (UniProt) | Nostoc sp. | Q8YKJ3 | BAB78388.1 | |
SS02314 | RSc0102 | Putative calcium binding hemolysin protein (UniProt) | Ralstonia solanacearum | Q8Y378 | CAD13630.1 | 15283662 |
SS02315 | RSc0104 | Putative hemolysin-type calcium-binding protein (UniProt, NCBI) | Ralstonia solanacearum | Q8Y377 | CAD13632.1 | 15283662 |
SS02316 | RSc0246 | Putative calcium binding hemolysin protein (UniProt, NCBI) | Ralstonia solanacearum | Q8Y2T6 | CAD13774.1 | 15283662 |
SS02317 | RSc0249 | Putative calcium binding hemolysin protein (UniProt) | Ralstonia solanacearum | Q8Y2T5 | WP_011000216.1 | 15283662 |
SS02318 | RSp0294 | Putative hemolysin-type calcium-binding protein (UniProt, NCBI) | Ralstonia solanacearum | Q8XT21 | CAD17445.1 | 15283662 |
SS02319 | RSp0295 | Putative hemolysin-type protein (UniProt, NCBI) | Ralstonia solanacearum | Q8XT20 | CAD17446.1 | 15283662 |
SS02320 | RSp1180 | Probable hemagglutinin/hemolysin-related protein (UniProt) | Ralstonia solanacearum | Q8XQP2 | WP_011004466.1 | 15283662 |
SS02321 | XAC1918 | Hemolysin related protein (UniProt) | Xanthomonas axonopodis | Q8PL85 | AJY82038.1 | 15808747 |
SS02322 | XAC2197 | Hemolysin-type calcium binding protein (UniProt) | Xanthomonas axonopodis | Q8PKH6 | AAM37050.1 | 15808747;10910347 |
SS02323 | XAC2198 | Hemolysin-type calcium binding protein (UniProt) | Xanthomonas axonopodis | Q8PKH5 | AAM37051.1 | 15808747;10910347 |
SS02324 | bpfA | Biofilm-promoting protein BpfA (UniProt) | Shewanella oneidensis | Q8E9G6 | WP_011073976.1 | 24626808 |
SS02325 | PP_0168 | Putative surface adhesion protein (UniProt) | Pseudomonas putida | Q88RG2 | 15546664 | |
SS02326 | PP_2561 | Putative secreted hemolysin-type calcium-binding bacteriocin (UniProt, NCBI) | Pseudomonas putida | Q88JT6 | AAN68170.2 | 23766110 |
SS02327 | PP_3849 | Putative calcium-binding protein, hemolysin-type (UniProt) | Pseudomonas putida | Q88G76 | WP_138868012.1 | |
SS02328 | PP_4924 | Serine protease, subtilase family (UniProt) | Pseudomonas putida | Q88DA3 | ||
SS02329 | bll3109 | Bll3109 protein (UniProt) | Bradyrhizobium diazoefficiens | Q89QL5 | WP_011085893.1 | |
SS02330 | bll3563 | Bll3563 protein (UniProt, NCBI) | Bradyrhizobium diazoefficiens | Q89PB9 | BAC48828.1 | |
SS02331 | bll3714 | Bll3714 protein (UniProt) | Bradyrhizobium diazoefficiens | Q89NW9 | ||
SS02332 | blr5821 | Blr5821 protein (UniProt) | Bradyrhizobium diazoefficiens | Q89I18 | WP_011088564.1 | |
SS02333 | bll6027 | Bll6027 protein (UniProt) | Bradyrhizobium diazoefficiens | Q89HG4 | WP_011088768.1 | |
SS02334 | bll7792 | Bll7792 protein (UniProt, NCBI) | Bradyrhizobium diazoefficiens | Q89CK5 | BAC53057.1 | |
SS02335 | PSPTO_3193 | Metalloprotease, putative (UniProt) | Pseudomonas syringae | Q880G6 | WP_011104426.1 | |
SS02336 | PSPTO_3332 | Alkaline metalloendoprotease (UniProt) | Pseudomonas syringae | Q87ZU2 | KKI27598.1 | |
SS02337 | PSPTO_4084 | Mannuronan C-5-epimerase, putative (UniProt) | Pseudomonas syringae | Q87XU1 | WP_011104868.1 | |
SS02338 | NE0161 | Hemolysin-type calcium-binding region:RTX N-terminal domain (UniProt) | Nitrosomonas europaea | Q82XT8 | WP_011110808.1 | |
SS02339 | BPP0974 | Putative hemolysin (UniProt) | Bordetella parapertussis | Q7WBN0 | WP_010927777.1 | |
SS02340 | BB1186 | Putative hemolysin (UniProt) | Bordetella bronchiseptica | A0A0H3LIZ4 | WP_010926070.1 | 29866808 |
SS02341 | PMT_0256 | Hemolysin-type calcium-binding region:RTX N-terminal domain (UniProt, NCBI) | Prochlorococcus marinus | Q7V8S5 | CAE20431.1 | |
SS02342 | PMT_0372 | Hemolysin-type calcium-binding protein (UniProt, NCBI) | Prochlorococcus marinus | Q7V8H5 | CAE20547.1 | |
SS02343 | PMT_0929 | Hemolysin-type calcium-binding region:RTX N-terminal domain (UniProt, NCBI) | Prochlorococcus marinus | Q7V733 | CAE21104.1 | |
SS02344 | swmA | Cell-surface-associated polypeptide SwmA (UniProt) | Synechococcus sp. | Q7UA16 | JC6140 | 20528947 |
SS02345 | SYNW0196 | Putative alkaline phosphatase (UniProt) | Synechococcus sp. | Q7U9Q7 | WP_011127072.1 | |
SS02346 | expE1 | Putative secreted calcium-binding protein (UniProt, NCBI) | Synechococcus sp. | Q7U7J8 | CAE07499.1 | |
SS02347 | SYNW1908 | Possible Zn-dependent metalloprotease (UniProt, NCBI) | Synechococcus sp. | Q7U504 | CAE08423.1 | |
SS02348 | SYNW2293 | Possible hemolysin-type calcium-binding protei (UniProt, NCBI) | Synechococcus sp. | Q7U3Y4 | CAE08808.1 | |
SS02349 | SYNW2304 | matrixin family metalloprotease (NCBI) | Synechococcus sp. | Q7U3X3 | WP_011129157.1 | |
SS02350 | SYNW2390 | Putative alkaline phosphatase/5' nucleotidase (UniProt) | Synechococcus sp. | Q7U3P0 | CRY93428.1 | |
SS02351 | SYNW2409 | Putative hemolysin-type calcium-binding protein similar to HlyA (UniProt, NCBI) | Synechococcus sp. | Q7U3M2 | CAE08924.1 | |
SS02352 | CV_0311 | Probable RTX (Repeat in structural toxin) (UniProt) | Chromobacterium violaceum | Q7P1A2 | WP_011133866.1 | 15100995 |
SS02353 | CV_0516 | Probable calcium binding hemolysin (UniProt) | Chromobacterium violaceum | Q7P0Q0 | 15100995;24535738 | |
SS02354 | zapE | Putative metalloprotease (UniProt) | Proteus mirabilis | B4EUL6 | WP_012367535.1 | |
SS02355 | apxIVA | ApxIVA (UniProt, Reference) | Actinobacillus pleuropneumoniae | C0M4V2 | ACN76442.1 | 20528947 |
SS02356 | plyA | PlyA (Reference); Polysaccharidase (UniProt) | Rhizobium leguminosarum | O05692 | WP_018243215.1 | 16740954;20528947 |
SS02357 | HasAp | HasAp (UniProt) | Pseudomonas aeruginosa | O69756 | WP_003115011.1 | 20947426 |
SS02358 | ehxA | EhxA (Reference); enterohemolysin EhxA (NCBI) | Escherichia coli | O85101 | WP_032489272.1 | 20528947 |
SS02359 | slaA | SlaA (Reference); Surface layer protein (UniProt) | Serratia marcescens | O87109 | WP_099981710.1 | 20528947 |
SS02360 | eprA | Metalloprotease (UniProt, NCBI) | Pseudomonas tolaasii | O87806 | CAA07697.1 | |
SS02361 | lipA | Extracellular lipase (UniProt, NCBI) | Serratia marcescens | Q09KJ5 | ABI83633.1 | 24129268;20528947 |
SS02362 | plyB | Polysaccharidase secreted via PrsDE Type I exporter (UniProt) | Rhizobium leguminosarum | Q1MEW2 | WP_011652539.1 | 16740954;20528947 |
SS02363 | prtW | M10 family metallopeptidase (NCBI) | Pectobacterium atrosepticum | Q6D3F9 | WP_011094320.1 | 15828685 |
SS02364 | Alkaline protease (UniProt, NCBI) | Pseudomonas aeruginosa | Q6SQM7 | AAR20883.1 | 3253732 | |
SS02365 | YPO3922 | Hemophore HasA (UniProt, NCBI) | Yersinia pestis | A0A0H2W798 | WP_002209484.1 | 11598042 |
SS02366 | p1 | Yrp1 (NCBI) | Yersinia ruckeri | Q93RN3 | AFK08628.1 | 12101310;15240252 |
SS02367 | lipA | LipA (UniProt, NCBI) | Pseudomonas brassicacearum | Q9KGS2 | AAF87594.1 | 11222613;24865936 |
SS02368 | aprA | AprA (UniProt, NCBI) | Pseudomonas brassicacearum | Q9KGS8 | AAF87588.1 | 11222613 |
SS02369 | rzcA | Rhizobiocin RzcA (UniProt) | Rhizobium leguminosarum | Q9LAE6 | 15044436 | |
SS02370 | hasA | heme acquisition protein HasA (NCBI) | Pseudomonas fluorescens | Q9RHT3 | ESW55346.1 | 10601212 |
SS02371 | prtA | zinc-binding metalloprotease PrtA (NCBI) | Erwinia amylovora | Q9XB65 | EKV52237.1 | 20192826;20528947 |
SS02372 | NMA1626 | Putative RTX-family exoprotein (UniProt) | Neisseria meningitidis | A0A0U1RJD9 | ||
SS02373 | SM_b20838 | Calcium binding protein (UniProt, NCBI) | Sinorhizobium meliloti | Q92VW6 | AGG71593.1 | |
SS02374 | rzcA | Rhizobiocin/RTX toxin (UniProt) | Agrobacterium tumefaciens | WP_035257655.1 | ||
SS02375 | hlyA | HlyA (Reference); Hemolysin, plasmid (UniProt) | Proteus vulgaris | A0A0G4Q7T4 | 8302219 | |
SS02376 | CRX48_04650 | HlyA (Reference); RTX toxin hemolysin A (UniProt, NCBI) | Morganella morganii | A0A2C5TL69 | QCY21538.1 | 8302219 |
SS02377 | ltxA | LtxA (Reference); RTX family leukotoxin LtxA (NCBI) | Aggregatibacter actinomycetemcomitans | P16462 | WP_005567703.1 | 20200418;20528947 |
SS02378 | ef0044 | CylL (Reference, UniProt) | Enterococcus faecalis | Q7B9F5 | EOE43258.1 | 8302219 |
SS02379 | spaS | SpaS (Reference); Lantibiotic subtilin (UniProt) | Bacillus subtilis | P10946 | WP_003220055.1 | 8302219 |
SS02380 | spaN | Nisin (Reference); Lantibiotic nisin-A (UniProt) | Lactococcus lactis | P13068 | ADZ63249.1 | 8302219 |
SS02381 | epiA | EpiA (Reference); Lantibiotic epidermin (UniProt) | Staphylococcus epidermidis | P08136 | WP_002498697.1 | 8302219 |
SS02382 | pedA | PedA (Reference); Bacteriocin pediocin PA-1 (UniProt) | Pediococcus acidilactici | P29430 | AAA98337.1 | 8302219 |
SS02383 | lcnA | LcnA (Reference); Bacteriocin lactococcin-A (UniProt, NCBI) | Lactococcus lactis | P0A313 | P0A312.1 | 8302219 |
SS02384 | N/A | LcnG (Reference); Bacteriocin lactococcin-G subunit beta (UniProt) | Lactococcus lactis | P36962 | WP_058212908.1 | 8302219 |
SS02385 | gdmA | Gallidermin (Reference); Lantibiotic gallidermin (UniProt) | Staphylococcus gallinarum | P21838 | WP_042739435.1 | 8302219 |
SS02386 | mbxA | Cytotoxin (UniProt) | Moraxella bovis | Q93GI2 | ABR28453.1 | 20528947 |
SS02387 | aqxA | AqxA (UniProt) | Actinobacillus equuli | Q8KWZ9 | AAM45566.1 | 20528947 |
SS02388 | rtxA | RTX toxin RtxA (UniProt) | Vibrio vulnificus | A7DV97 | 20528947 | |
SS02389 | CMV05_06120 | RTX toxin RtxA (UniProt) | Vibrio anguillarum | A0A290PLC2 | 20528947 | |
SS02390 | C9J66_04285 | Type I secretion C-terminal target domain-containing protein (UniProt) | Vibrio cholerae | A0A2V4NK47 | 20528947 | |
SS02391 | aprX | Metalloprotease AprX (UniProt) | Pseudomonas fluorescens | A0A1T2ZEG4 | PQA98933.1 | 20528947 |
SS02392 | rtxA | 2-aminoethylphosphonate--pyruvate transaminase (UniProt) | Bradyrhizobium elkanii | Q93HS5 | BAB55900.1 | 20528947 |
SS02393 | rtxA | RtxA (UniProt) | Xanthomonas oryzae | Q5H327 | WP_011258200.1 | 20528947 |
SS02394 | rzcA | Rhizobiocin/RTX toxin (UniProt) | Agrobacterium tumefaciens | Q7CUW1 | WP_010973826.1 | 20528947 |
SS02395 | crs | S-layer protein (UniProt, NCBI) | Campylobacter rectus | O30524 | AAC46210.1 | 20528947 |
SS02396 | csxA | S-layer-RTX protein (UniProt, NCBI) | Campylobacter rectus | Q9ZIB3 | AAD02005.1 | 20528947 |
SS02397 | csxB | S-layer-RTX protein (UniProt, NCBI) | Campylobacter rectus | Q9ZIB5 | AAD02003.1 | 20528947 |
SS02398 | N/A | Oscillin (UniProt, NCBI) | Phormidium uncinatum | O51813 | AAC46039.1 | 20528947 |
SS02399 | algE1 | Mannuronan C5-epimerase AlgE1 (UniProt, NCBI) | Azotobacter vinelandii | Q44494 | Q44494.1 | 16855245 |
SS02400 | algE2 | Mannuronan C5-epimerase AlgE2 (UniProt, NCBI) | Azotobacter vinelandii | Q44495 | Q44495.1 | 16855245 |
SS02401 | algE3 | Mannuronan C5-epimerase AlgE3 (UniProt) | Azotobacter vinelandii | Q44496 | 16855245 | |
SS02402 | algE5 | Mannuronan C5-epimerase AlgE5 (UniProt) | Azotobacter vinelandii | Q44492 | Q44492.1 | 16855245 |
SS02403 | algE6 | Mannuronan C5-epimerase AlgE6 (UniProt) | Azotobacter vinelandii | Q9ZFH0 | Q9ZFH0.1 | 16855245 |
SS02404 | frpC | Bacteriocin (UniProt, NCBI) | Xylella fastidiosa | Q87BM1 | AAO29274.1 | 17427810 |
SS02405 | XF_0175 | Hemolysin III protein (UniProt) | Xylella fastidiosa | Q9PGX3 | ETE35852.1 | 17427810 |
SS02406 | XF_0984 | Gamma-glutamyltranspeptidase (UniProt) | Xylella fastidiosa | Q9PEP4 | ARO69252.1 | 17427810 |
SS02407 | XF_1280 | Uncharacterized protein (UniProt) | Xylella fastidiosa | Q9PDU9 | 17427810 | |
SS02408 | metF | Methylenetetrahydrofolate reductase (UniProt) | Xylella fastidiosa | Q87EA5 | AAO28292.1 | 17427810 |
SS02409 | PD_0282 | membrane protein insertion efficiency factor YidD (NCBI) | Xylella fastidiosa | Q87EM1 | WP_011097572.1 | 17427810 |
SS02410 | tlyC | Hemolysin (UniProt, NCBI) | Xylella fastidiosa | Q87DZ3 | AAO28409.1 | 17427810 |
SS02411 | PD_1506 | Hemolysin-type calcium binding protein (UniProt, NCBI) | Xylella fastidiosa | Q87BF0 | ADN62349.1 | 17427810 |
SS02412 | frpC | Hemolysin-type calcium binding protein (UniProt, NCBI) | Xylella fastidiosa | Q87EK2 | hemolysin-type calcium binding protein | 17427810 |
SS02413 | frpC | Hemolysin-type calcium binding protein (UniProt) | Xylella fastidiosa | Q879U6 | EGO81411.1 | 17427810 |
SS02414 | frpC | Hemolysin-type calcium binding protein (UniProt) | Xylella fastidiosa | Q879U3 | WP_011098373.1 | 17427810 |
SS02415 | XF_0262 | Colicin V (UniProt) | Xylella fastidiosa | Q9PGN6 | AAF83075.1 | 17427810 |
SS02416 | XF_0263 | Colicin V (UniProt) | Xylella fastidiosa | Q9PGN5 | AAF83076.1 | 17427810 |
SS02417 | cvaC | Colicin V (UniProt) | Xylella fastidiosa | Q87ET3 | ACB91659.1 | 17427810 |
SS02418 | PD_0216 | Colicin V (UniProt) | Xylella fastidiosa | Q87ET2 | ADN63209.1 | 17427810 |
SS02419 | lipAPF33 | Extracellular lipase (UniProt, NCBI) | Pseudomonas fluorescens | Q9ZNI4 | BAA36468.1 | 10524213 |
SS02421 | pueB | PueB (Reference); Polyurethanase B (UniProt) | Pseudomonas chlororaphis | Q9R9H2 | AAF01331.1 | 18045391 |
T2SS substrate
BastionHub ID | Gene Name | Brief Description
![]() |
Species | UniProt ID | NCBI ID | PubMed ID |
---|---|---|---|---|---|---|
SS02143 | lasB | LasB (Reference); M4 family elastase LasB (NCBI) | Pseudomonas aeruginosa | P14756 | WP_003113835.1 | 9642203 |
SS02144 | plcH | PlcH (Reference); Hemolytic phospholipase C (UniProt, NCBI) | Pseudomonas aeruginosa | P06200 | P06200.2 | 11726509 |
SS02145 | lasA | LasA (Reference); Protease LasA (UniProt) | Pseudomonas aeruginosa | P14789 | AAA25873.1 | 9642203 |
SS02146 | plcN | PlcN (Reference); Non-hemolytic phospholipase C (UniProt) | Pseudomonas aeruginosa | P15713 | WP_003113149.1 | 11726509 |
SS02147 | plcB | PlcB (Reference); Phospholipase C, PlcB (UniProt) | Pseudomonas aeruginosa | Q9I7A4 | NP_248716.1 | 15306013 |
SS02148 | cbpD | CbpD (Reference); Chitin-binding protein CbpD (UniProt, NCBI) | Pseudomonas aeruginosa | Q9I589 | WP_003114231.1 | 10671445 |
SS02149 | eta | ToxA (Reference); Exotoxin A (UniProt, NCBI) | Pseudomonas aeruginosa | P11439 | WP_003112478.1 | 7901198 |
SS02150 | impA | IMPa (Reference); Immunomodulating metalloprotease (UniProt) | Pseudomonas aeruginosa | Q9I5W4 | NP_249263.1 | 20947426 |
SS02151 | prpL | PrpL (Reference); Lysyl endopeptidase (UniProt, NCBI) | Pseudomonas aeruginosa | Q9HWK6 | Q9HWK6.1 | 18203852 |
SS02152 | lipA | LipA (Reference); Triacylglycerol lipase (UniProt, NCBI) | Pseudomonas aeruginosa | P26876 | WP_048521053.1 | 7946464 |
SS02153 | lipC | LipC (Reference); Lipase LipC (UniProt) | Pseudomonas aeruginosa | Q9HUZ7 | 10564475 | |
SS02154 | phoA | PhoA (Reference); Alkaline phosphatase H (UniProt, NCBI) | Pseudomonas aeruginosa | P35483 | P35483.2 | 3138529 |
SS02155 | lap | PaAP (Reference); Aminopeptidase Y (Arg, Lys, Leu preference) (NCBI) | Pseudomonas aeruginosa | Q9HZQ8 | EYT99895.1 | 9642203 |
SS02156 | loxA | LoxA (Reference); Lipoxygenase LoxA (UniProt) | Pseudomonas aeruginosa | Q9I4G8 | ERW27709.1 | 14766977 |
SS02157 | PA2377 | ABC transporter substrate-binding protein (NCBI) | Pseudomonas aeruginosa | Q9I1A2 | WP_003122690.1 | 26341027 |
SS02158 | eddA | Extracelullar DNA degradation protein, EddA (UniProt) | Pseudomonas aeruginosa | Q9HXA3 | AGV61862.1 | 26341027 |
SS02159 | PA4140 | FAD-binding PCMH-type domain-containing protein (UniProt) | Pseudomonas aeruginosa | Q9HWP1 | NP_252829.1 | 26341027 |
SS02160 | PA2783 | Mep72 (Reference); CBM-cenC domain-containing protein (UniProt) | Pseudomonas aeruginosa | Q9I060 | NP_251473.1 | 25488299 |
SS02161 | glpQ | GlpQ (Reference); Glycerophosphoryl diester phosphodiesterase, periplasmic (UniProt) | Pseudomonas aeruginosa | Q9I6E6 | 19028883 | |
SS02162 | phoA2 | LapA (Reference); Alkaline phosphatase L (UniProt) | Pseudomonas aeruginosa | P35482 | 11985723 | |
SS02163 | PA0689 | LapB (Reference); hypothetical protein PA0689 (NCBI) | Pseudomonas aeruginosa | Q9I5N7 | NP_249380.1 | 11985723 |
SS02164 | phoA2 | LapC (Reference); Alkaline phosphatase L (UniProt, NCBI) | Pseudomonas aeruginosa | Q02HI0 | Q02HI0.1 | 11985723 |
SS02165 | cbpE | CbpE(CbpD) (Reference); CbpE (UniProt) | Pseudomonas aeruginosa | A6V168 | WP_012074647.1 | 24748613 |
SS02166 | plaC | PlaC (Reference); Glycerophospholipid:cholesterol acyltransferase (UniProt) | Legionella pneumophila | Q5DJS6 | AAW66486.1 | 15845496 |
SS02167 | lpg1385 | NttA (Reference); hypothetical protein lpg1385 (NCBI) | Legionella pneumophila | Q5ZVQ5 | AAU27467.1 | 23429532 |
SS02168 | proA | ProA (Reference); type II secretion system effector ProA, partial (NCBI) | Legionella pneumophila | CCC42092.1 | 18083880 | |
SS02169 | lpg2848 | SrnA (Reference); Ribonuclease, T2 family (UniProt, NCBI) | Legionella pneumophila | Q5ZRN2 | AAU28896.1 | 19246759 |
SS02170 | lpg2622 | NttB (Reference); hypothetical protein lpg2622 (NCBI) | Legionella pneumophila | Q5ZS97 | AAU28680.1 | 23429532 |
SS02171 | legP | LegP (Reference); Dot/Icm T4SS effector LegP (NCBI) | Legionella pneumophila | Q5ZR84 | WP_010948683.1 | 23429532 |
SS02172 | chiA | ChiA (Reference); putative bifunctional chitinase/lysozyme precursor (NCBI) | Legionella pneumophila | AMV15035.1 | 17148602 | |
SS02173 | map | Map (Reference); Acid phosphatase (UniProt) | Legionella pneumophila | Q9APF7 | WP_027265797.1 | 11119504 |
SS02174 | plaA | PlaA (Reference); lysophospholipase A (NCBI) | Legionella pneumophila | AAN63820.1 | 12379686 | |
SS02175 | plcA | PlcA (Reference); putative phospholipase C (NCBI) | Legionella pneumophila | AAM73854.1 | 12101309 | |
SS02176 | Lpg2622 (Reference); C1 family peptidase (NCBI) | Legionella pneumophila | WP_010948322.1 | 19722835 | ||
SS02177 | Lpg1918 (Reference); cellulase family glycosylhydrolase (NCBI) | Legionella pneumophila | WP_010947635.1 | 19722835 | ||
SS02178 | DUF1566 domain-containing protein(NCBI); Lpg2644 (Reference) | Legionella pneumophila | WP_010948344.1 | 19722835 | ||
SS02179 | Lpg1809 (Reference); hypothetical protein (NCBI) | Legionella pneumophila | WP_010947535.1 | 19722835 | ||
SS02180 | Lpg1385 (Reference); hypothetical protein (NCBI) | Legionella pneumophila | WP_010947115.1 | 19722835 | ||
SS02181 | Lpg0873 (Reference); hypothetical protein (NCBI) | Legionella pneumophila | WP_010946609.1 | 19722835 | ||
SS02182 | Lpg0189 (Reference); Lpg0189 family type II secretion system effector (NCBI) | Legionella pneumophila | WP_010945950.1 | 19722835 | ||
SS02183 | Lpg0956 (Reference); DUF4785 family protein (NCBI) | Legionella pneumophila | WP_010946691.1 | 19722835 | ||
SS02184 | Lpg0264 (Reference); N-acetylmuramoyl-L-alanine amidase (NCBI) | Legionella pneumophila | WP_010946025.1 | 19722835 | ||
SS02185 | Lpg1832 (Reference); VirK family protein (NCBI) | Legionella pneumophila | WP_010947558.1 | 19722835 | ||
SS02186 | GamA (Reference); hypothetical protein lpp0489 (NCBI) | Legionella pneumophila | CAH11637.1 | 20965781 | ||
SS02187 | chiY | ChiY (Reference); ChiY protein (NCBI) | Yersinia enterocolitica | CAC83040.2 | 19968791 | |
SS02188 | chiA | ChiA (Reference); Probable bifunctional chitinase/lysozyme (NCBI) | Escherichia coli | P13656.2 | 10760150 | |
SS02189 | yghJ | SslE (Reference); putative lipoprotein YghJ (NCBI) | Escherichia coli | YP_026189.1 | 22451516 | |
SS02190 | eltA | LptA(EltA) (Reference); heat-labile enterotoxin A chain precursor (lt-a, porcine) (ltp-a) (plasmid) (NCBI) | Escherichia coli | CBJ04426.1 | 12011463 | |
SS02191 | yghJ | YghJ (Reference); Putative lipoprotein YghJ (NCBI) | Escherichia coli | E3PJ90.1 | 24478067 | |
SS02192 | cpI | CPI (Reference); Haloprotease CPI (UniProt) | Pseudoalteromonas ruthenica | C5J5F5 | CAR94714.1 | 19376897 |
SS02193 | lipA | LipA (Reference); lipase (NCBI) | Acinetobacter baumannii | ABW70205.1 | 26668261 | |
SS02194 | LipAN (Reference); hypothetical protein A1S_3473 (plasmid) (NCBI) | Acinetobacter baumannii | ABO13862.1 | 27713027 | ||
SS02195 | CpaA (Reference); metallopeptidase (NCBI) | Acinetobacter nosocomialis | ERL68477.1 | 26764912 | ||
SS02196 | LipH (Reference); alpha/beta hydrolase (NCBI) | Acinetobacter nosocomialis | ERL68190.1 | 26764912 | ||
SS02197 | aerA | AerA (Reference); Aerolysin (NCBI) | Aeromonas hydrophila | P09167.2 | 3584074 | |
SS02198 | BURPS688_3454 (Reference); serine carboxypeptidase family protein (NCBI) | Burkholderia pseudomallei | ABN81427.1 | 16518399 | ||
SS02199 | BURPS688_1221 (Reference); conserved hypothetical protein (NCBI) | Burkholderia pseudomallei | ABN84437.1 | 16518399 | ||
SS02200 | plcN_2 | BURPS688_0358 (Reference); non-hemolytic phospholipase C (NCBI) | Burkholderia pseudomallei | ABN81562.1 | 16518399 | |
SS02201 | ctxB | VC1456-57 ctxAB (Reference); cholera enterotoxin binding subunit CtxB (NCBI) | Vibrio cholerae | Q56635 | WP_000593522.1 | 7704895 |
SS02202 | cholera enterotoxin, A subunit (NCBI) | Vibrio cholerae | AAF94614.1 | 7704895 | ||
SS02203 | hap | VCA0865 (Reference); hemagglutinin/proteinase HapA (NCBI) | Vibrio cholerae | P24153 | WP_000782181.1 | 6417020 |
SS02204 | VC1784 | VC1784 (Reference); exo-alpha-sialidase (NCBI) | Vibrio cholerae | WP_001889713.1 | 1730470 | |
SS02205 | hlyA | VCA0219 (Reference); cytolysin and hemolysin HlyA Pore-forming toxin (NCBI) | Vibrio cholerae | P09545 | ACQ62004.1 | 19333391 |
SS02206 | gbpA | VCA0811 (Reference); GlcNAc-binding protein A (UniProt) | Vibrio cholerae | A6XA54 | KKP10811.1 | 14983042 |
SS02207 | VC_A0812 | VCA0812 (Reference); Leucine aminopeptidase-related protein (UniProt) | Vibrio cholerae | Q9KLD4 | WP_001890356.1 | 8890197 |
SS02208 | VC_A0813 | VCA0813 (Reference); Aminopeptidase (UniProt) | Vibrio cholerae | Q9KLD3 | WP_001037204.1 | 21385872 |
SS02209 | VC_0930 | VC0930 (Reference); Hemolysin-related protein (UniProt) | Vibrio cholerae | Q9KTH2 | ACQ61564.1 | 17220218 |
SS02210 | VC_A0803 | VCA0803 (Reference); GlyGly-anchored extracellular serine protease VesA (NCBI) | Vibrio cholerae | Q9KLE3 | WP_001233647.1 | 21385872 |
SS02211 | VC_1200 | VC1200 (Reference); GlyGly-anchored extracellular serine protease VesB (NCBI) | Vibrio cholerae | Q9KSQ6 | WP_000554395.1 | 21385872 |
SS02212 | VC_1649 | VC1649 (Reference); GlyGly-anchored extracellular serine protease VesC (NCBI) | Vibrio cholerae | Q9KRJ1 | WP_001043985.1 | 20927349 |
SS02213 | VC_A0148 | VCA0148 (Reference); TagA-related protein (UniProt, NCBI) | Vibrio cholerae | Q9KN18 | AAF96061.1 | 21385872 |
SS02214 | VC_1952 | VC1952 (Reference); chitinase A domain protein (NCBI) | Vibrio cholerae | Q9KQP6 | EGQ97456.1 | 14983042 |
SS02215 | VC_A0027 | VCA0027 (Reference); chitinase A (NCBI) | Vibrio cholerae | Q9KND8 | EGR00745.1 | 14983042 |
SS02216 | cod | chitin oligosaccharide deacetylase (NCBI) | Vibrio cholerae | WP_001881046.1 | 14983042 | |
SS02217 | VC0769 (Reference); chitinase, putative (NCBI) | Vibrio cholerae | AAF93934.1 | 14983042 | ||
SS02218 | VCA0140 (Reference); lytic polysaccharide monooxygenase (NCBI) | Vibrio cholerae | WP_001882986.1 | 14983042 | ||
SS02219 | VCA0738 (Reference); hypothetical protein VC_A0738 (NCBI) | Vibrio cholerae | AAF96637.1 | 21385872 | ||
SS02220 | VC2298 (Reference); lipoprotein, putative (NCBI) | Vibrio cholerae | AAF95442.1 | 21385872 | ||
SS02221 | prtV | PrtV (Reference); Pre-pro-metalloprotease PrtV (UniProt) | Vibrio cholerae | Q9KMU6 | WP_002033169.1 | 26222047 |
SS02222 | pehA | PehA (Reference); Endo-polygalacturonase (UniProt) | Pectobacterium atrosepticum | Q6D880 | ACX89060.1 | 11929517 |
SS02223 | pelB | PelC (Reference); pectate lyase (NCBI) | Dickeya chrysanthemi | CAA47821.1 | 10922032 | |
SS02224 | Cel5 (Reference); Chain C, Cellulase Cel5 From Erwinia Chrysanthemi, A Family Gh 5-2 Enzyme (NCBI) | Dickeya chrysanthemi | 1EGZ_C | 11501995 | ||
SS02225 | pnlH | PnlH (Reference); Pectate lyase (UniProt) | Dickeya dadantii | E0SG38 | ADM98893.1 | 18643934 |
T3SS substrate
BastionHub ID | Gene Name | Brief Description
![]() |
Species | UniProt ID | NCBI ID | PubMed ID |
---|---|---|---|---|---|---|
SS00001 | hopZ2 | Type III effector HopZ2 (UniProt) | Pseudomonas amygdali | A0FDW2 | WP_005746524.1 | 26120140 |
SS00002 | hopZ2 | Type III effector HopZ2 (UniProt, NCBI) | Pseudomonas coronafaciens | A0FDW6 | ABK13721.1 | 26120140 |
SS00003 | hopZ2 | Type III effector HopZ2 (UniProt, NCBI) | Pseudomonas syringae | A0FDW7 | ABK13722.1 | 26120140 |
SS00004 | hopZ2 | Type III effector HopZ2 (UniProt) | Pseudomonas amygdali | A0FDW8 | WP_081026843.1 | 22230763 |
SS00005 | hopZ2 | Type III effector HopZ2 (UniProt) | Pseudomonas syringae | A0FDX1 | WP_003407175.1 | 26120140 |
SS00006 | aexT | AexT (UniProt) | Aeromonas veronii | A0FKE4 | WP_031227428.1 | 17656370 |
SS00007 | AexU (UniProt, Reference) | Aeromonas veronii | A0FKE5 | WP_021229262.1 | 19534604 | |
SS00008 | YE3534 | putative yspA (NCBI) | Yersinia enterocolitica | A1JQ83 | AJJ23947.1 | 24391954 |
SS00009 | yopT1 | Cysteine protease yopT1 (UniProt) | Yersinia enterocolitica | A1JU65 | WP_011117629.1 | 24391954 |
SS00010 | yopM | Yop type III secretion system effector protein (UniProt) | Yersinia enterocolitica | A1JU68 | WP_011117630.1 | 29891548 |
SS00011 | yscX | Yop proteins translocation protein X (UniProt) | Yersinia enterocolitica | A1JU78 | WP_002212969.1 | 24391954 |
SS00012 | YEP0050 | T3SS effector protein-tyrosine-phosphatase YopH (NCBI) | Yersinia enterocolitica | A1JUA6 | WP_011117644.1 | 24391954 |
SS00013 | YEP0053 | type III secretion system effector GTPase activator YopE (NCBI) | Yersinia enterocolitica | A1JUA9 | WP_011117646.1 | 24391954 |
SS00014 | yopO | type III secretion system gatekeeper subunit MxiC (NCBI) | Yersinia enterocolitica | A1JUC4 | WP_011100759.1 | 24391954 |
SS00015 | nleA1 | NleA1 protein (UniProt) | Escherichia coli | A1KWP2 | WP_024238215.1 | 17553972 |
SS00016 | nleA2 | NleA2 protein (UniProt, NCBI) | Escherichia coli | A1KWP3 | CAM11314.1 | 17553972 |
SS00017 | nleA3 | NleA3 protein (UniProt) | Escherichia coli | A1KWP4 | WP_045903964.1 | 17553972 |
SS00018 | nleA4 | NleA4 protein (UniProt, NCBI) | Escherichia coli | A1KWP5 | CAM11316.1 | 17553972 |
SS00019 | nleA5 | NleA5 protein (UniProt) | Escherichia coli | A1KWP6 | WP_033810147.1 | 17553972 |
SS00020 | nleA6-1 | NleA6-1 protein (UniProt, NCBI) | Escherichia coli | A1KWP7 | CAM11318.1 | 17553972 |
SS00021 | nleA6-2 | NleA6-2 protein (UniProt, NCBI) | Escherichia coli | A1KWP8 | CAM11319.1 | 17553972 |
SS00022 | nleA7 | NleA7 protein (UniProt, NCBI) | Escherichia coli | A1KWP9 | CAM11320.1 | 17553972 |
SS00023 | nleA8-1 | NleA8-1 protein (UniProt) | Escherichia coli | A1KWQ0 | WP_001025664.1 | 17553972 |
SS00024 | nleA8-2 | NleA8-2 protein (UniProt) | Escherichia coli | A1KWQ1 | WP_001025663.1 | 17553972 |
SS00025 | nleA9 | NleA9 protein (UniProt, NCBI) | Escherichia coli | A1KWQ2 | CAM11323.1 | 17553972 |
SS00026 | nleA10 | NleA10 protein (UniProt, NCBI) | Escherichia coli | A1KWQ3 | CAM11324.1 | 17553972 |
SS00027 | nleA11 | NleA11 protein (UniProt) | Escherichia coli | A1KWQ4 | AET12018.1 | 17553972 |
SS00028 | tccP | Tir-cytoskeleton coupling protein TccP (NCBI) | Escherichia coli | A2A0W5 | WP_010917831.1 | 26120140 |
SS00029 | tccP | Tir-cytoskeleton coupling protein TccP (NCBI) | Escherichia coli | A2A0W7 | WP_171877906.1 | 24391954 |
SS00030 | tccP2 | Tir-cytoskeleton coupling protein TccP2 (NCBI) | Escherichia coli | A2A0X2 | WP_107686092.1 | 26120140 |
SS00031 | tccP2 | Tir-cytoskeleton coupling protein TccP2 (NCBI) | Escherichia coli | A2A0X3 | WP_052912734.1 | 19390696 |
SS00032 | tccP2 | Type III secreted effector protein (UniProt, NCBI) | Escherichia coli | A2A0X5 | BAF45440.1 | 26120140 |
SS00033 | tccP2 | Type III secreted effector protein (UniProt) | Escherichia coli | A2A0X8 | WP_012817749.1 | 26120140 |
SS00034 | tccP2 | Type III secreted effector protein (UniProt) | Escherichia coli | A2A0Y3 | WP_012817749.1 | 26120140 |
SS00035 | tccP2 | Tir-cytoskeleton coupling protein TccP2 (NCBI) | Escherichia coli | A2A0Y6 | WP_012817858.1 | 26120140 |
SS00036 | tccP2 | Type III effector (UniProt, NCBI) | Escherichia coli | A2A0Z2 | WP_012817749.1 | 26120140 |
SS00037 | tccP2 | Tir-cytoskeleton coupling protein TccP2 (NCBI) | Escherichia coli | A2A0Z4 | 26120140 | |
SS00038 | tccP2 | Tir-cytoskeleton coupling protein TccP2 (NCBI) | Escherichia coli | A2A0Z6 | 26120140 | |
SS00039 | AvrPphF protein (UniProt, NCBI) | Pseudomonas savastanoi | A2BCU8 | CAM12736.1 | 26120140 | |
SS00040 | HsvG virulence protein (UniProt, NCBI) | Pantoea agglomerans | A2I8A1 | ABM66110.1 | 16879413 | |
SS00041 | hsvB | HsvB type III effector (UniProt, NCBI) | Pantoea agglomerans | A2I8A2 | ABM66111.1 | 16879413 |
SS00042 | bipB | Translocator protein BipB (UniProt) | Burkholderia mallei | A2S1Q0 | WP_004533397.1 | 24391954 |
SS00043 | bipC | Effector protein BipC (UniProt) | Burkholderia mallei | A2S1Q1 | WP_004203135.1 | 25165162 |
SS00044 | bipD | Translocator protein BipD (UniProt) | Burkholderia mallei | A2S1Q3 | WP_004188590.1 | 24391954 |
SS00045 | bopE | Guanine nucleotide exchange factor BopE (UniProt, NCBI) | Burkholderia mallei | A2S1Q7 | WP_004188462.1 | 21106126 |
SS00046 | bopA | Effector protein BopA (UniProt) | Burkholderia mallei | A2S1Q9 | WP_004187505.1 | 21412437 |
SS00047 | bipB | Translocator protein BipB (UniProt) | Burkholderia mallei | A3MCG8 | WP_004533397.1 | |
SS00048 | bipC | Effector protein BipC (UniProt, NCBI) | Burkholderia mallei | A3MCG9 | A2S1Q1.2 | |
SS00049 | bipD | Translocator protein BipD (UniProt) | Burkholderia mallei | A3MCH1 | WP_004188590.1 | |
SS00050 | bopE | Guanine nucleotide exchange factor BopE (UniProt, NCBI) | Burkholderia mallei | A3MCH6 | A2S1Q7.1 | 24391954 |
SS00051 | bopA | Effector protein BopA (UniProt) | Burkholderia mallei | A3MCH8 | WP_004187505.1 | 26120140 |
SS00052 | bopA | Effector protein BopA (UniProt) | Burkholderia pseudomallei | A3NLC6 | WP_011853452.1 | 21106126 |
SS00053 | bopE | Guanine nucleotide exchange factor BopE (UniProt) | Burkholderia pseudomallei | A3NLC8 | WP_004528812.1 | 24391954 |
SS00054 | bipD | Translocator protein BipD (UniProt) | Burkholderia pseudomallei | A3NLD2 | WP_004188590.1 | 25635268 |
SS00055 | bipC | Effector protein BipC (UniProt) | Burkholderia pseudomallei | A3NLD4 | WP_028359003.1 | 27634329 |
SS00056 | bipB | Translocator protein BipB (UniProt) | Burkholderia pseudomallei | A3NLD5 | WP_011853456.1 | 25635268 |
SS00057 | bopA | Effector protein BopA(UniProt) | Burkholderia pseudomallei | A3P6Y8 | WP_004536698.1 | 26120140 |
SS00058 | bopE | Guanine nucleotide exchange factor BopE (UniProt, NCBI) | Burkholderia pseudomallei | A3P6Z0 | AGZ30748.1 | 12897019 |
SS00059 | bipD | Translocator protein BipD (UniProt) | Burkholderia pseudomallei | A3P6Z4 | WP_004537374.1 | |
SS00060 | bipC | Effector protein BipC (UniProt) | Burkholderia pseudomallei | A3P6Z6 | WP_004551891.1 | |
SS00061 | bipB | Translocator protein BipB (UniProt) | Burkholderia pseudomallei | A3P6Z7 | WP_004537550.1 | |
SS00062 | hopI1 | HopI1 (UniProt) | Pseudomonas syringae | A3QQZ4 | 26120140 | |
SS00063 | hopI1 | hopI1 (UniProt) | Pseudomonas syringae | A3QQZ7 | 26120140 | |
SS00064 | hopI1 | hopI1 (UniProt) | Pseudomonas syringae | A3QQZ8 | ABD65205.1 | 26120140 |
SS00065 | hopI1 | hopI1 (UniProt) | Pseudomonas syringae | A3QQZ9 | 26120140 | |
SS00066 | hopI1 | hopI1 (UniProt, NCBI) | Pseudomonas syringae | A3QR00 | ABD65207.1 | 26120140 |
SS00067 | hopI1 | hopI1 (UniProt) | Pseudomonas syringae | A3QR01 | PBP71311.1 | 26120140 |
SS00068 | tccP2 | Tir-cytoskeleton coupling protein TccP2 (NCBI) | Escherichia coli | A4PCI6 | WP_032165226.1 | 26120140 |
SS00069 | tccP2 | Tir-cytoskeleton coupling protein (UniProt, NCBI) | Escherichia coli | A4PCI7 | BAF52035.1 | 26120140 |
SS00070 | tccP2 | Tir-cytoskeleton coupling protein (UniProt, NCBI) | Escherichia coli | A4PDT6 | BAF52358.1 | 26120140 |
SS00071 | tccP2 | Tir-cytoskeleton coupling protein (UniProt, NCBI) | Escherichia coli | A4PDT7 | BAF52359.1 | 26120140 |
SS00072 | tccP2 | Tir-cytoskeleton coupling protein (UniProt, NCBI) | Escherichia coli | A4PDT8 | BAF52360.1 | 26120140 |
SS00073 | tccP2 | Tir-cytoskeleton coupling protein (UniProt, NCBI) | Escherichia coli | A4PDT9 | BAF52361.1 | 26120140 |
SS00074 | tccP2 | Tir-cytoskeleton coupling protein TccP2 (NCBI) | Escherichia coli | A4PDU1 | WP_052924591.1 | 26120140 |
SS00075 | tccP2 | Tir-cytoskeleton coupling protein (UniProt, NCBI) | Escherichia coli | A4PDU2 | BAF52364.1 | 26120140 |
SS00076 | tccP2 | Tir-cytoskeleton coupling protein (UniProt, NCBI) | Escherichia coli | A4PDU3 | BAF52365.1 | 26120140 |
SS00077 | tccP2 | Tir-cytoskeleton coupling protein TccP2 (NCBI) | Escherichia coli | A4PDU4 | WP_096071309.1 | 26120140 |
SS00078 | tccP2 | Tir-cytoskeleton coupling protein (UniProt, NCBI) | Escherichia coli | A4PDU5 | BAF52367.1 | 26120140 |
SS00079 | tccP2 | Tir-cytoskeleton coupling protein TccP2 (NCBI) | Escherichia coli | A4PDU6 | WP_096071309.1 | 26120140 |
SS00080 | tccP2 | Tir-cytoskeleton coupling protein TccP2 (NCBI) | Escherichia coli | A4PDU7 | WP_000610783.1 | 26120140 |
SS00081 | tccP2 | Tir-cytoskeleton coupling protein (UniProt) | Escherichia coli | A4PDU8 | WP_106898774.1 | 26120140 |
SS00082 | tccP2 | Tir-cytoskeleton coupling protein (UniProt, NCBI) | Escherichia coli | A4PDU9 | BAF52371.1 | 26120140 |
SS00083 | tccP2 | Tir-cytoskeleton coupling protein TccP2 (NCBI) | Escherichia coli | A4PDV0 | WP_061317672.1 | 26120140 |
SS00084 | tccP2 | Tir-cytoskeleton coupling protein TccP2 (NCBI) | Escherichia coli | A4PDV1 | WP_061317672.1 | 26120140 |
SS00085 | tccP2 | Tir-cytoskeleton coupling protein (UniProt, NCBI) | Escherichia coli | A4PDV2 | BAF52374.1 | 26120140 |
SS00086 | tccP2 | Tir-cytoskeleton coupling protein TccP2 (NCBI) | Escherichia coli | A4PDV3 | WP_096071309.1 | 26120140 |
SS00087 | tccP2 | Tir-cytoskeleton coupling protein TccP2 (NCBI) | Escherichia coli | A4PDV5 | WP_000610783.1 | 26120140 |
SS00088 | tir | Translocated intimin receptor Tir (UniProt) | Escherichia coli | A4PHQ3 | WP_059215485.1 | 12410841 |
SS00089 | tir | Translocated intimin receptor Tir (UniProt, NCBI) | Escherichia coli | A4PHQ4 | BAF52549.1 | 26120140 |
SS00090 | ASA_P5G045 | T3SS effector inositol phosphatase Ati2 (NCBI) | Aeromonas salmonicida | A4SUE7 | WP_011899436.1 | 24391954 |
SS00091 | aexT | AexT (UniProt, NCBI) | Aeromonas hydrophila | A6YCJ6 | ABR13262.1 | 26120140 |
SS00092 | tir | Translocated intimin receptor Tir (UniProt) | Escherichia coli | A8R3Y1 | WP_024231660.1 | 26120140 |
SS00093 | SARI_01766 | type III secretion system effector SifA (NCBI) | Salmonella arizonae | A9MG90 | EAA9131191.1 | 22252866 |
SS00094 | sseL | type III secretion system effector deubiquitinase SseL (NCBI) | Salmonella arizonae | A9MJD1 | EAA5368605.1 | 26120140 |
SS00095 | sseL | SPI-2 type III secretion system effector deubiquitinase SseL (NCBI) | Salmonella enterica | A9N5C6 | WP_001017732.1 | 17158898 |
SS00096 | lcrV | type III secretion system needle tip protein LcrV (NCBI) | Yersinia pestis | A9R9H4 | WP_012228705.1 | 28512097 |
SS00097 | ECO26H__140003 | Non-LEE-encoded effector NleH (UniProt) | Escherichia coli | A9ZNE5 | AHG07528.1 | 24391954 |
SS00098 | nleG | Non-LEE-encoded effector NleG (UniProt) | Escherichia coli | A9ZNE9 | EJE91668.1 | 26120140 |
SS00099 | espJ | EspJ family T3SS effector ADP-ribosyltransferase (UniProt) | Escherichia coli | A9ZNF2 | WP_001121571.1 | 24391954 |
SS00100 | nleH | Non-LEE-encoded effector NleH (UniProt) | Escherichia coli | A9ZNF7 | AHG07528.1 | 26120140 |
SS00101 | espJ | Non-LEE-encoded effector EspJ (UniProt) | Escherichia coli | A9ZNG0 | WP_001121571.1 | 26120140 |
SS00102 | nleB | Non-LEE-encoded effector NleB (UniProt) | Escherichia coli | A9ZNG5 | WP_000950792.1 | 16552063 |
SS00103 | nleH | Non-LEE-encoded effector NleH (UniProt) | Escherichia coli | A9ZNG6 | EEC7212555.1 | 26120140 |
SS00104 | nleG | Non-LEE-encoded effector NleG (UniProt) | Escherichia coli | A9ZNG7 | EES2576226.1 | 26120140 |
SS00105 | nleA | Non-LEE-encoded effector NleA (UniProt) | Escherichia coli | A9ZNG8 | WP_001102750.1 | 26120140 |
SS00106 | incD | Inclusion membrane protein IncD (NCBI) | Chlamydia trachomatis | B0B9M3 | WP_009873570.1 | 19390696 |
SS00107 | incE | Inclusion membrane protein IncE (NCBI) | Chlamydia trachomatis | B0B9M4 | WP_009873571.1 | 19390696 |
SS00108 | incF | Inclusion membrane protein IncF(NCBI) | Chlamydia trachomatis | B0B9M5 | WP_009873572.1 | 19390696 |
SS00109 | espM3 | EspM3 protein (UniProt) | Citrobacter rodentium | B1GVN9 | WP_012907283.1 | 18331467 |
SS00110 | SbBS512_A0136 | OspC3 (UniProt, NCBI) | Shigella boydii | B2TSV7 | AAP78984.1 | 23684308 |
SS00111 | ipaH9.8 | E3 ubiquitin-protein ligase ipaH9.8 (UniProt) | Shigella boydii | B2TT54 | WP_012421769.1 | 24391954 |
SS00112 | T3SS secreted effector NleB-homolog (UniProt) | Escherichia coli | B3Y094 | WP_000950790.1 | 26120140 | |
SS00113 | T3SS secreted effector NleH-homolog (UniProt) | Escherichia coli | B3Y095 | EDX28270.1 | 26120140 | |
SS00114 | T3SS secreted effector NleA-homolog (UniProt) | Escherichia coli | B3Y098 | WP_001102750.1 | 26120140 | |
SS00115 | T3SS secreted effector, TccP2 (UniProt) | Escherichia coli | B3Y0A5 | WP_048818235.1 | 26120140 | |
SS00116 | T3SS secreted effector NleF-homolog (UniProt) | Escherichia coli | B3Y0U1 | EDX27920.1 | 26120140 | |
SS00117 | T3SS secreted effector EspM-homolog (UniProt) | Escherichia coli | B3Y1A0 | EHW88736.1 | 18331467 | |
SS00118 | T3SS secreted effector NleE-homolog (UniProt) | Escherichia coli | B3Y1M9 | WP_000609744.1 | 24391954 | |
SS00119 | sopA | E3 ubiquitin-protein ligase SopA (UniProt) | Salmonella enterica | B4SX34 | WP_000703996.1 | 24391954 |
SS00120 | sopA | E3 ubiquitin-protein ligase SopA (UniProt) | Salmonella enterica | B4T918 | WP_000704000.1 | |
SS00121 | sopA | E3 ubiquitin-protein ligase SopA (UniProt) | Salmonella enterica | B4TMK5 | WP_000704007.1 | |
SS00122 | SeAg_B1559 | SPI-2 type III secretion system effector SifB (NCBI) | Salmonella agona | B5F5S8 | AKC52824.1 | 26120140 |
SS00123 | SeAg_B1960 | SPI-2 type III secretion system effector SifA (NCBI) | Salmonella agona | B5F8C9 | AKC53184.1 | 26120140 |
SS00124 | sopA | E3 ubiquitin-protein ligase SopA (UniProt) | Salmonella enterica | B5FM34 | WP_000703992.1 | |
SS00125 | sopA | E3 ubiquitin-protein ligase SopA (UniProt) | Salmonella enterica | B5QZK6 | WP_000703991.1 | |
SS00126 | SG1233 | Type III secretion system, secreted effector protein (SopE) (UniProt) | Salmonella enterica | B5R8S6 | WP_000161702.1 | 24391954 |
SS00127 | E2348C_2916 | T3SS secreted effector EspG homolog (UniProt, NCBI) | Escherichia coli | B7UH72 | CAS10464.1 | 26120140 |
SS00128 | E2348C_3230 | T3SS secreted effector EspL homolog (UniProt) | Escherichia coli | B7UI20 | WP_001121619.1 | 26120140 |
SS00129 | E2348C_3231 | T3SS secreted effector NleB homolog (UniProt) | Escherichia coli | B7UI21 | WP_012578998.1 | 26120140 |
SS00130 | E2348C_3232 | T3SS secreted effector NleE homolog (UniProt) | Escherichia coli | B7UI22 | WP_000609744.1 | 26120140 |
SS00131 | E2348C_0718 | T3SS secreted effector NleH homolog (UniProt, NCBI) | Escherichia coli | B7ULW4 | WP_000950983.1 | 26120140 |
SS00132 | E2348C_0723 | T3SS secreted effector EspJ homolog (UniProt) | Escherichia coli | B7ULW8 | WP_001121571.1 | 26120140 |
SS00133 | E2348C_3930 | LEE-encoded effector EspF (UniProt) | Escherichia coli | B7UM88 | WP_012579019.1 | 26120140 |
SS00134 | E2348C_3936 | Translocon EspA (UniProt) | Escherichia coli | B7UM94 | WP_000381567.1 | 23437191 |
SS00135 | tir | Translocated intimin receptor Tir (UniProt) | Escherichia coli | B7UM99 | WP_001339882.1 | 26120140 |
SS00136 | map | LEE-encoded effector Map (UniProt, NCBI) | Escherichia coli | B7UMA0 | CAS11490.1 | 26120140 |
SS00137 | espH | LEE-encoded effector EspH (UniProt, NCBI) | Escherichia coli | B7UMA2 | SLM08785.1 | 26120140 |
SS00138 | espG | LEE-encoded effector EspG (UniProt, NCBI) | Escherichia coli | B7UMC8 | CAS11518.1 | 26120140 |
SS00139 | E2348C_0814 | hypothetical protein HMPREF9536_05150 (NCBI) | Escherichia coli | B7UMR0 | EFJ84609.1 | 26120140 |
SS00140 | E2348C_1040 | T3SS secreted effector NleI/NleG homolog (UniProt) | Escherichia coli | B7UNX2 | WP_012578869.1 | 26120140 |
SS00141 | E2348C_1041 | T3SS effector-like protein NleB homolog (UniProt) | Escherichia coli | B7UNX3 | WP_000950813.1 | 26120140 |
SS00142 | E2348C_1042 | T3SS secreted effector NleC homolog (UniProt) | Escherichia coli | B7UNX4 | WP_000701341.1 | 26120140 |
SS00143 | E2348C_1044 | T3SS secreted effector NleD homolog (UniProt) | Escherichia coli | B7UNX6 | WP_001247931.1 | 26120140 |
SS00144 | E2348C_1442 | T3SS secreted effector NleA/EspI homolog (UniProt) | Escherichia coli | B7UR60 | EHU16393.1 | 26120140 |
SS00145 | E2348C_1444 | T3SS secreted effector NleH homolog (UniProt) | Escherichia coli | B7UR62 | WP_000950979.1 | 26120140 |
SS00146 | E2348C_1445 | T3SS secreted effector NleF homolog (UniProt) | Escherichia coli | B7UR63 | WP_000938103.1 | 26120140 |
SS00147 | map | T3SS effector protein Map (NCBI) | Escherichia coli | B8ZY94 | WP_000938103.1 | 24391954 |
SS00148 | espH | Type III secretion system, translocated effector protein, LEE associated (UniProt, NCBI) | Escherichia coli | B8ZY96 | CAX18574.1 | 24391954 |
SS00149 | sepZ | T3SS secreted effector EspZ (UniProt) | Escherichia coli | B8ZYA3 | WP_000386952.1 | 26120140 |
SS00150 | map | T3SS effector protein Map (NCBI) | Escherichia coli | B8ZYG0 | WP_032314772.1 | 26120140 |
SS00151 | espH | Type III secretion system, translocated effector protein, LEE associated (UniProt, NCBI) | Escherichia coli | B8ZYG2 | CAX18649.1 | 26120140 |
SS00152 | L537_047 | type III secretion system protein SepZ (NCBI) | Escherichia coli | B8ZYN7 | WP_062893434.1 | 25561713 |
SS00153 | vopL | putative type III secretion system effector protein VopL (UniProt, NCBI) | Vibrio parahaemolyticus | B9A807 | BAH15041.1 | 17942696 |
SS00154 | vopC | Putative type III secretion system effector protein VopC (UniProt, NCBI) | Vibrio parahaemolyticus | B9A810 | BAH15044.1 | 22787576 |
SS00155 | avrA | RipAA-effector family protein (NCBI) | Ralstonia solanacearum | C0SPP7 | WP_172833510.1 | 27073091 |
SS00156 | popP2 | YOPP/AvrRxv family protein (NCBI) | Ralstonia solanacearum | C0SPP9 | RAA04514.1 | 24391954 |
SS00157 | ripT | type III effector protein ript (NCBI) | Ralstonia solanacearum | C0SPQ0 | AST85151.1 | 24391954 |
SS00158 | hpx38 | AVRPPHE avirulence protein (UniProt, NCBI) | Ralstonia solanacearum | C0SPQ1 | APF85338.1 | 17427805 |
SS00160 | hpx40 | Type III effector HopG1 (UniProt, NCBI) | Ralstonia solanacearum | C0SPQ3 | AUS45631.1 | 19863557 |
SS00161 | hpx43 | Hrp-secreted outer protein (UniProt) | Ralstonia solanacearum | C0SPQ6 | WP_016723760.1 | 10922033 |
SS00162 | nopC | Nodulation protein NopC (UniProt, NCBI) | Bradyrhizobium elkanii | C4PL71 | BBC02554.1 | 26569401 |
SS00163 | nopA | Nodulation protein NopA (UniProt, NCBI) | Bradyrhizobium elkanii | C4PL72 | WP_075968406.1 | 23437191 |
SS00164 | nopM | Nodulation protein NopM (NCBI) | Bradyrhizobium elkanii | C4PL85 | BBC02569.1 | 22615567 |
SS00165 | VopF (UniProt, NCBI) | Vibrio cholerae | C5IZN1 | ACS27545.1 | 19779031 | |
SS00166 | espF(U) | Secreted effector protein EspF(U) (UniProt) | Escherichia coli | C6UYI3 | WP_010917831.1 | |
SS00167 | avrE1 | AvrE1 (UniProt, NCBI) | Pseudomonas syringae | C8BNV1 | ACU65043.1 | 19445595 |
SS00168 | hopM1 | HopM1 (UniProt, NCBI) | Pseudomonas syringae | C8BNW8 | ACU65060.1 | 24324742 |
SS00169 | exoU | ExoU (UniProt, NCBI) | Pseudomonas syringae | C8BNX0 | WP_100069506.1 | 14500525 |
SS00170 | ECO26_1162 | Type III effector (UniProt, NCBI) | Escherichia coli | A0A3J9C4M3 | WP_012817749.1 | 26120140 |
SS00171 | ECO9455_03421 | T3SS effector EspG (UniProt, NCBI) | Escherichia coli | K4WT30 | EIL17425.1 | 26120140 |
SS00172 | ECO9455_03331 | T3SS effector EspZ (UniProt) | Escherichia coli | K4XZX3 | CAC81859.1 | 25561713 |
SS00173 | espH | EspH protein (UniProt) | Escherichia coli | Q9AJ11 | AWJ35492.1 | 22372637 |
SS00174 | ECO9455_03291 | T3SS effector Map (UniProt) | Escherichia coli | K4WP32 | AWJ35494.1 | 26120140 |
SS00175 | espF | type III secretion system LEE effector EspF (NCBI) | Escherichia coli | Q9RQE1 | WP_001443729.1 | 26120140 |
SS00176 | espF | type III secretion system LEE effector EspF (NCBI) | Escherichia coli | Q5K5R0 | WP_001368749.1 | 26120140 |
SS00177 | map | T3SS effector protein Map (NCBI) | Escherichia coli | Q5K5P8 | AUF78826.1 | 26120140 |
SS00178 | espH | Secretion protein EspH (UniProt, NCBI) | Escherichia coli | Q5K5P6 | EEC7212685.1 | 26120140 |
SS00179 | espZ | type III secretion system protein SepZ (NCBI) | Escherichia coli | A0A0F3TK69 | WP_000338353.1 | 26120140 |
SS00180 | espG | secretion protein EspG (NCBI) | Escherichia coli | Q5K5M1 | ASJ44898.1 | 26120140 |
SS00181 | nleE | T3SS effector protein NleE (UniProt) | Escherichia coli | A0A023Z7G9 | WP_000609742.1 | 23437191 |
SS00182 | nleB | Type III secretion system effector arginine glycosyltransferase NleB (UniProt, NCBI) | Escherichia coli | A0A6D1F6N9 | WP_000953024.1 | 28860194 |
SS00183 | espG | T3SS secreted effector EspG (UniProt) | Escherichia coli | C8UFJ4 | AMF90434.1 | 26120140 |
SS00184 | espF | T3SS secreted effector EspF (UniProt) | Escherichia coli | C8UFJ7 | WP_001369486.1 | 26120140 |
SS00185 | espH | T3SS secreted effector EspH (UniProt) | Escherichia coli | C8UFL1 | AWJ46882.1 | 26120140 |
SS00186 | espZ | T3SS secreted effector EspZ (UniProt) | Escherichia coli | C8UFL8 | WP_000386952.1 | 26120140 |
SS00187 | ECO111_1081 | T3SS secreted effector TccP2 (UniProt) | Escherichia coli | C8UMB1 | WP_012817858.1 | 26120140 |
SS00188 | sopA | E3 ubiquitin-protein ligase SopA (UniProt) | Salmonella enterica | C9X8K0 | WP_000703995.1 | |
SS00189 | eseD | Type III secretion system effector protein D (UniProt, NCBI) | Edwardsiella tarda | D0ZDK9 | ACY83714.1 | 24391954 |
SS00190 | eseC | Type III secretion system effector protein C (UniProt) | Edwardsiella tarda | D0ZDL0 | AGH72966.1 | 24391954 |
SS00191 | steB | SteB (Reference); Secreted effector protein SteB (UniProt) | Salmonella enterica | D0ZI38 | ASE80998.1 | 16177297 |
SS00192 | steC | Secreted effector kinase SteC (UniProt) | Salmonella enterica | D0ZIB5 | WP_001116926.1 | 23015760 |
SS00193 | sopA | E3 ubiquitin-protein ligase SopA (UniProt) | Salmonella enterica | D0ZMG9 | WP_000703998.1 | 14762020 |
SS00194 | sspH2 | E3 ubiquitin-protein ligase SspH2 (UniProt) | Salmonella enterica | D0ZPH9 | WP_001115840.1 | 23935490 |
SS00195 | slrP | E3 ubiquitin-protein ligase SlrP (UniProt) | Salmonella enterica | D0ZRB2 | WP_000481997.1 | 19690162 |
SS00196 | sspH1 | E3 ubiquitin-protein ligase SspH1 (UniProt) | Salmonella enterica | D0ZVG2 | WP_000481981.1 | 16611232 |
SS00197 | steA | Secreted effector protein SteA (UniProt) | Salmonella enterica | D0ZXR5 | WP_001147134.1 | 24858684 |
SS00198 | IS481a | Transposase (UniProt, NCBI) | Bordetella pertussis | D1MWR4 | BAI59725.1 | 23437191 |
SS00199 | ospB | OspB, probably secreted by the Mxi-Spa machinery (UniProt) | Shigella flexneri | D2AJ46 | WP_001046939.1 | 19017275 |
SS00200 | ospD2 | OspD2, probably secreted by the Mxi-Spa machinery (UniProt,NCBI) | Shigella flexneri | D2AJ54 | ADA76735.1 | 29866849 |
SS00201 | ospD1 | OspD1, probably secreted by the Mxi-Spa machinery (UniProt) | Shigella flexneri | D2AJ70 | WP_000026470.1 | 19017268 |
SS00202 | ospD3 | OspD3, probably secreted by the Mxi-Spa machinery (UniProt, NCBI) | Shigella flexneri | D2AJE7 | ADA76828.1 | 24391954 |
SS00203 | ipaA | IpaA, secreted by the Mxi-Spa machinery, modulates entry of bacteria into epithelial cells (UniProt) | Shigella flexneri | D2AJI2 | WP_005083511.1 | 24391954 |
SS00204 | ipaH9.8 | E3 ubiquitin-protein ligase ipaH9.8 (UniProt) | Shigella flexneri | D2AJU0 | WP_000936806.1 | |
SS00205 | ospG | Shigella flexneri | D2AJU3 | WP_000705601.1 | 23469023 | |
SS00206 | espT | T3SS effector protein EspT (UniProt) | Citrobacter rodentium | D2TI15 | WP_012908046.1 | 21848814 |
SS00207 | espS | T3SS effector protein EspS (UniProt, NCBI) | Citrobacter rodentium | D2TJZ3 | CBG87121.1 | 24391954 |
SS00208 | espI | T3SS effector protein NleA/EspI (UniProt) | Citrobacter rodentium | D2TJZ4 | WP_012904700.1 | 15039354 |
SS00209 | nleC | T3SS effector protein NleC (UniProt) | Citrobacter rodentium | D2TK70 | AAS47019.1 | 25040221 |
SS00210 | nleG1 | Putative T3SS effector protein NleG1 (UniProt) | Citrobacter rodentium | D2TK72 | WP_012905902.1 | 27822540 |
SS00211 | espG | T3SS effector protein EspG (UniProt, NCBI) | Citrobacter rodentium | D2TKD5 | AAL06389.1 | 15039354 |
SS00212 | espF | Citrobacter rodentium | D2TKD7 | WP_012907101.1 | 15039354 | |
SS00213 | espB | T3SS effector protein EspB (UniProt) | Citrobacter rodentium | D2TKE1 | WP_012907105.1 | 25645555 |
SS00214 | espD | T3SS translocator protein EspD (UniProt) | Citrobacter rodentium | D2TKE2 | WP_012907106.1 | 25645555 |
SS00215 | map | T3SS effector protein Map (UniProt, NCBI) | Citrobacter rodentium | D2TKE9 | WP_012907113.1 | 26120140 |
SS00216 | espH | T3SS effector protein EspH (UniProt, NCBI) | Citrobacter rodentium | D2TKF1 | CBG89721.1 | 15039354 |
SS00217 | espZ | T3SS effector protein EspZ (UniProt, NCBI) | Citrobacter rodentium | D2TKF8 | WP_012907122.1 | 23437191 |
SS00218 | grlA | GrlA, global regulator of LEE activator (UniProt) | Citrobacter rodentium | D2TKG4 | WP_012907128.1 | 24391954 |
SS00219 | grlR | GrlR, global regulator of LEE repressor (UniProt, NCBI) | Citrobacter rodentium | D2TKG5 | CBG89736.1 | 24391954 |
SS00220 | ler | Ler transcriptional regulator (UniProt) | Citrobacter rodentium | D2TKH5 | AAL06349.1 | 24391954 |
SS00221 | nleD-1 | T3SS effector protein NleD (UniProt, NCBI) | Citrobacter rodentium | D2TML3 | WP_012904922.1 | 23437191 |
SS00222 | ROD_09131 | phage tail assembly protein (NCBI) | Citrobacter rodentium | D2TRA0 | WP_012905236.1 | 24391954 |
SS00223 | nleH | T3SS effector protein NleH (UniProt) | Citrobacter rodentium | D2TRX7 | AAS48169.1 | 23437191 |
SS00224 | nleF | T3SS effector protein NleF (UniProt) | Citrobacter rodentium | D2TRX8 | AAS48168.1 | 23437191 |
SS00225 | espJ | T3SS effector protein EspJ (UniProt) | Citrobacter rodentium | D2TRY1 | WP_012908744.1 | 23437191 |
SS00226 | nleB1 | T3SS effector protein NleB1 (UniProt) | Citrobacter rodentium | D2TT37 | WP_012905389.1 | 26120140 |
SS00227 | nleE | T3SS effector protein NleE (UniProt) | Citrobacter rodentium | D2TT38 | WP_012905390.1 | 20485572 |
SS00228 | espX7 | Putative T3SS effector protein EspX7 (UniProt) | Citrobacter rodentium | D2TTX7 | WP_012905489.1 | 23437191 |
SS00229 | sipA | Type III secretion effector protein SipA (UniProt, NCBI) | Arsenophonus nasoniae | D2TZ31 | CBA72793.1 | 24391954 |
SS00230 | yopB | Type III secretion effector protein IpaD, SipD, SspD, YopB (UniProt) | Arsenophonus nasoniae | D2TZ32 | WP_081700632.1 | 24391954 |
SS00231 | sipB | Type III secretion effector protein SipB (UniProt) | Arsenophonus nasoniae | D2TZ34 | WP_026822347.1 | 24391954 |
SS00232 | yscW | Type III secreted effector protein YopN,Yop4b,LcrE,InvE (UniProt, NCBI) | Arsenophonus nasoniae | D2TZV2 | CBA73375.1 | 24391954 |
SS00233 | ORFB | Avirulence protein ORFB (UniProt, NCBI) | Erwinia amylovora | D4HVP7 | EKV55411.1 | 20565644 |
SS00234 | dspE | putative avirulence protein DspE (DspA) (UniProt, NCBI) | Erwinia amylovora | D4HVQ0 | EKV55414.1 | 19737101 |
SS00235 | eop2 | Type III effector HopAK1 (UniProt, NCBI) | Erwinia amylovora | D4HWC7 | WP_004155599.1 | 24391954 |
SS00236 | HopPtoC | Probable cysteine protease avirulence protein avrPpiC2 (UniProt) | Erwinia amylovora | D4HWL8 | WP_004155795.1 | 24391954 |
SS00237 | avrRpt2 | Cysteine protease avirulence protein avrRpt2 (UniProt) | Erwinia amylovora | D4I1J6 | CBA23177.1 | 16776298 |
SS00238 | xopQ | nucleoside hydrolase (NCBI) | Xanthomonas citri | A0A1U8ZCV1 | WP_007963549.1 | 26120140 |
SS00239 | TP45_00795 | AvrBs2 type three effector (NCBI) | Xanthomonas citri | A0A2R2WFH5 | AEZ54398.1 | 24391954 |
SS00240 | xopE1 | avirulence protein (NCBI) | Xanthomonas citri | D4TBP8 | AMU96925.1 | 23437191 |
SS00241 | xopB | type III secretion XopB family effector (NCBI) | Xanthomonas citri | D4T148 | TCK49512.1 | 23437191 |
SS00242 | xopQ | nucleoside hydrolase (NCBI) | Xanthomonas citri | D4T570 | WP_007963549.1 | 26120140 |
SS00244 | RCFBP_mp20290 | Putative type III effector, AWR3 (UniProt, NCBI) | Ralstonia solanacearum | D8P480 | WP_013208225.1 | 26120140 |
SS00245 | RCFBP_mp20473 | AWR5 type III effector protein (UniProt, NCBI) | Ralstonia solanacearum | D8P4R3 | WP_013208397.1 | 26120140 |
SS00246 | ripA | Type III effector protein AWR2 (UniProt) | Ralstonia solanacearum | D8P729 | YP_003747289.1 | 26120140 |
SS00247 | sipA | Cell invasion protein SipA (UniProt) | Salmonella enterica | E1WAC6 | WP_000258811.1 | 19390696 |
SS00248 | hopBB1 | HopBB1 (UniProt) | Pseudomonas amygdali | E5G0U5 | ADQ74896.1 | 28132837 |
SS00249 | Pgy4_29625 | Type III effector AvrRps4 (UniProt, NCBI) | Pseudomonas savastanoi | E7PH30 | EFW87133.1 | 26120140 |
SS00250 | Pgy4_04597 | Type III effector HopI1 (UniProt) | Pseudomonas savastanoi | E7PJ45 | WP_004655586.1 | 26120140 |
SS00251 | Pgy4_06407 | Type III effector AvrE1 (UniProt) | Pseudomonas savastanoi | E7PKT3 | WP_122390119.1 | 26120140 |
SS00252 | Pgy4_06582 | Type III effector HopX1 (UniProt) | Pseudomonas savastanoi | E7PKW2 | RMO14137.1 | 26120140 |
SS00253 | Pgy4_26220 | Type III effector HopAU1 (UniProt) | Pseudomonas savastanoi | E7PLP1 | RMM85621.1 | 26120140 |
SS00254 | Pgy4_42589 | Type III effector HopH1 (UniProt, NCBI) | Pseudomonas savastanoi | E7PP21 | EFW77376.1 | 26120140 |
SS00256 | ALQ80_02949 | Type III effector HopY1 (UniProt, NCBI) | Pseudomonas coronafaciens | A0A3M3D8Y0 | RMM33735.1 | 26120140 |
SS00257 | ALQ48_03573 | Type III effector HopAA1-2 (UniProt) | Pseudomonas coronafaciens | A0A3M3SCD9 | RMO06323.1 | 26120140 |
SS00265 | ALP71_00174 | Type III effector HopAG1 (UniProt) | Pseudomonas coronafaciens | A0A0P9UWK9 | WP_005895613.1 | 26120140 |
SS00273 | ALQ94_03040 | Type III effector HopAG1 (UniProt) | Pseudomonas amygdali | A0A3M2WRQ9 | EGH06702.1 | 26120140 |
SS00275 | ALQ94_02994 | Type III effector protein AvrE1 (UniProt) | Pseudomonas amygdali | A0A2S4IJ75 | WP_005736337.1 | 26120140 |
SS00282 | ALQ94_03113 | Type III effector HopA1 (NCBI) | Pseudomonas amygdali | A0A2S4I4L1 | EGH13275.1 | 26120140 |
SS00283 | ALQ94_03114 | Type III effector HopA1 (UniProt, NCBI) | Pseudomonas amygdali | A0A2S4I4K0 | WP_005740288.1 | 26120140 |
SS00284 | ALQ94_00928 | Type III effector HopAU1 (UniProt, NCBI) | Pseudomonas amygdali | A0A3M2WSV6 | EGH14446.1 | 26120140 |
SS00286 | PSYMO_03328 | Type III effector HopI1 (UniProt, NCBI) | Pseudomonas amygdali | A0A656G4D5 | EGH20568.1 | 26120140 |
SS00287 | PSYMO_25909 | Type III effector HopAB2 (UniProt, NCBI) | Pseudomonas amygdali | A0A656GG29 | EGH24698.1 | 26120140 |
SS00288 | PSYMO_38638 | hypothetical protein PSYMO_38638 (NCBI) | Pseudomonas amygdali | A0A656GNA3 | EGH27097.1 | 26120140 |
SS00289 | PSYJA_02014 | Type III effector HopI1 (UniProt) | Pseudomonas syringae | F3FCB6 | 26120140 | |
SS00290 | PSYJA_03539 | Type III effector HopAA1 (UniProt, NCBI) | Pseudomonas syringae | F3FD33 | EGH28119.1 | 26120140 |
SS00291 | PSYJA_03564 | Type III effector protein AvrE1 (Unipro, NCBI) | Pseudomonas syringae | F3FD38 | EGH28124.1 | 26120140 |
SS00292 | PSYJA_03719 | Type III effector HopZ3 (UniProt, NCBI) | Pseudomonas syringae | F3FD65 | EGH28151.1 | 26120140 |
SS00293 | PSYPI_00155 | Type III effector HopA1 (UniProt) | Pseudomonas syringae | F3G1H5 | 19525323 | |
SS00294 | PSYPI_01205 | Type III effector HopX1 (UniProt) | Pseudomonas syringae | F3G207 | EGH41107.1 | 26120140 |
SS00295 | PSYPI_01212 | Type III effector HopX1 (UniProt) | Pseudomonas syringae | F3G208 | EGH41108.1 | 26120140 |
SS00296 | PSYPI_01402 | Type III effector protein AvrE1 (UniProt, NCBI) | Pseudomonas syringae | F3G242 | EGH41142.1 | 26120140 |
SS00297 | PSYPI_01432 | Type III effector HopAA1 (UniProt, NCBI) | Pseudomonas syringae | F3G248 | EGH41148.1 | 26120140 |
SS00298 | PSYPI_05543 | Type III effector HopI1 (UniProt) | Pseudomonas syringae | F3G4A3 | WP_003340856.1 | 26120140 |
SS00299 | PSYPI_21055 | Type III effector HopH1 (UniProt, NCBI) | Pseudomonas syringae | F3GCB9 | WP_003345750.1 | 26120140 |
SS00300 | PSYPI_25434 | Type III effector HopAG1 (UniProt) | Pseudomonas syringae | F3GEH5 | WP_003347056.1 | 26120140 |
SS00301 | PSYPI_26319 | Type III effector AvrRps4 (UniProt, NCBI) | Pseudomonas syringae | F3GEX7 | 26120140 | |
SS00302 | B1F71_01040 | HopA1 (UniProt) | Pseudomonas syringae | A0A1H1MQF9 | ALE00933.1 | 26120140 |
SS00303 | PSYCIT7_05440 | Type III effector protein AvrE1 (UniProt, NCBI) | Pseudomonas syringae | A0A656GSU4 | EGH51103.1 | 26120140 |
SS00304 | PSYCIT7_05470 | Type III effector HopAA1 (UniProt, NCBI) | Pseudomonas syringae | A0A656GSX5 | EGH51109.1 | 26120140 |
SS00305 | PSYCIT7_23615 | Type III effector HopAG1 (UniProt, NCBI) | Pseudomonas syringae | A0A656H0U7 | EGH54560.1 | 26120140 |
SS00306 | PSYCIT7_30927 | Type III effector HopI1 (UniProt) | Pseudomonas syringae | A0A656H641 | EGH55913.1 | 26120140 |
SS00307 | PSYCIT7_31346 | Type III effector HopI1 (UniProt) | Pseudomonas syringae | A0A656H5T7 | EGH55986.1 | 26120140 |
SS00308 | PSYCIT7_31811 | Type III effector HopI1 (UniProt) | Pseudomonas syringae | A0A656H7M6 | EGH56078.1 | 26120140 |
SS00309 | PSYCIT7_32870 | Type III effector HopI1 (UniProt) | Pseudomonas syringae | A0A656H7U2 | EGH56289.1 | 26120140 |
SS00311 | PMA4326_02677 | Type III effector AvrE1 (UniProt) | Pseudomonas syringae | A0A0N0FKK8 | WP_007248467.1 | 26120140 |
SS00320 | AC507_3920 | Type III effector HopO1-1 (UniProt, NCBI) | Pseudomonas syringae | A0A0N0FBJ7 | KPB71124.1 | 26120140 |
SS00322 | PLA106_02720 | Type III effector HopI1 (UniProt, NCBI) | Pseudomonas amygdali | F3ICX9 | AAO58206.1 | 26120140 |
SS00323 | PLA106_03887 | Type III effector HopF2 (UniProt, NCBI) | Pseudomonas amygdali | F3IDL2 | EGH95106.1 | 26120140 |
SS00324 | PLA106_04187 | Type III effector protein AvrE1 (UniProt, NCBI) | Pseudomonas amygdali | F3IDS2 | EGH95178.1 | 26120140 |
SS00325 | PLA106_04212 | Type III effector HopAA1-1 (UniProt, NCBI) | Pseudomonas amygdali | F3IDS7 | EGH95183.1 | 26120140 |
SS00326 | PLA106_10666 | Type III effector HopAB2 (UniProt, NCBI) | Pseudomonas amygdali | F3IHD9 | EGH96534.1 | 26120140 |
SS00327 | PLA106_13794 | Type III effector HopA1 (UniProt, NCBI) | Pseudomonas amygdali | F3IJ53 | EGH97169.1 | 26120140 |
SS00328 | PLA106_14206 | Type III effector HopAH2-1 (UniProt) | Pseudomonas amygdali | F3IJD5 | WP_005767312.1 | 26120140 |
SS00329 | PLA106_14211 | Type III effector HopAH2-2 (UniProt) | Pseudomonas amygdali | F3IJD6 | 26120140 | |
SS00330 | PLA106_21293 | Type III effector HopY1 (UniProt, NCBI) | Pseudomonas amygdali | F3INB8 | AAO53615.1 | 26120140 |
SS00331 | PLA106_22398 | Type III effector HopAG1 (UniProt) | Pseudomonas amygdali | F3INY7 | EGH98853.1 | 26120140 |
SS00332 | PLA106_22443 | Type III effector HopAG1 (UniProt) | Pseudomonas amygdali | F3INZ6 | EGH98862.1 | 26120140 |
SS00333 | PLA106_22878 | Pseudomonas amygdali | F3IP81 | EGH98947.1 | 26120140 | |
SS00334 | PLA106_22883 | Type III effector HopO1-3 (UniProt, NCBI) | Pseudomonas amygdali | F3IP82 | EGH98948.1 | 26120140 |
SS00335 | PLA106_22888 | Type III effector HopO1-2 (UniProt, NCBI) | Pseudomonas amygdali | F3IP83 | EGH98949.1 | 26120140 |
SS00336 | PLA106_27176 | Type III effector HopS2 (UniProt, NCBI) | Pseudomonas amygdali | F3IRM5 | EGH99791.1 | 26120140 |
SS00337 | PLA106_27186 | Type III effector HopO1-2 (UniProt, NCBI) | Pseudomonas amygdali | F3IRM7 | WP_005771670.1 | 26120140 |
SS00341 | ALO35_01977 | Type III effector HopI1 (UniProt) | Pseudomonas amygdali | A0A0N1JIP6 | WP_005745414.1 | 26120140 |
SS00345 | ALP03_03173 | Type III effector HopT1-1 (UniProt, NCBI) | Pseudomonas amygdali | A0A3M6G7Q0 | RMV88885.1 | 26120140 |
SS00349 | hopAA1-1 | Type III effector HopAA1-1 (UniProt, NCBI) | Pseudomonas syringae | G3XDB9 | KPY91178.1 | 26120140 |
SS00350 | xopQ | Type III effector protein XopQ (UniProt, NCBI) | Xanthomonas oryzae | G7TIR4 | AEQ94357.1 | 26120140 |
SS00351 | hopAU1 | Type III effector HopAU1 (UniProt, NCBIt) | Pseudomonas syringae | G9I6Y2 | AEV42014.1 | 26120140 |
SS00352 | outer protein D (UniProt, NCBI) | Xanthomonas campestris | G9L9K6 | AEU04524.1 | 26120140 | |
SS00353 | xopQ | Type III effector protein (UniProt) | Xanthomonas arboricola | H2BNU5 | AEX33790.1 | 26120140 |
SS00354 | xopQ | Type III effector protein (UniProt) | Xanthomonas arboricola | H2BNU9 | AEX33794.1 | 26120140 |
SS00355 | xopQ | Type III effector protein (UniProt) | Xanthomonas campestris | H2BNV7 | AEX33794.1 | 26120140 |
SS00356 | xopQ | Type III effector protein (UniProt) | Xanthomonas axonopodis | H2EMV1 | AEX58663.1 | 26120140 |
SS00357 | xopR | T3SS effector protein XopR (NCBI) | Xanthomonas oryzae | H6UWS2 | AFV08855.1 | 26120140 |
SS00358 | H9L407 | type III secretion systems effector SseF (NCBI) | Salmonella enterica | H9L407 | WP_000690718.1 | 26120140 |
SS00359 | sseE | pathogenicity island 2 effector protein SseE (NCBI) | Salmonella enterica | H9L446 | WP_151253718.1 | 26120140 |
SS00360 | spvB | Salmonella enterica | H9L477 | YP_003864189.1 | 26120140 | |
SS00361 | sseG | pathogenicity island 2 effector protein SseG (NCBI) | Salmonella enterica | H9L486 | WP_000805851.1 | 26120140 |
SS00362 | hopAB3 | AvrPtoB type III effector (UniProt) | Pseudomonas syringae | I1V8A5 | AFI33127.1 | 26120140 |
SS00363 | hopAB3 | AvrPtoB type III effector (UniProt) | Pseudomonas syringae | I1V8A6 | AFI33128.1 | 26120140 |
SS00364 | hopAB3 | AvrPtoB type III effector (UniProt) | Pseudomonas syringae | I1V8A7 | AFI33129.1 | 26120140 |
SS00365 | hopAB3 | AvrPtoB type III effector (UniProt) | Pseudomonas syringae | I1V8A8 | AFI33130.1 | 26120140 |
SS00366 | hopAB2 | AvrPtoB type III effector (UniProt) | Pseudomonas syringae | I1V8A9 | AFI33131.1 | 26120140 |
SS00367 | hopAB2 | AvrPtoB type III effector (UniProt) | Pseudomonas syringae | I1V8B0 | AFI33132.1 | 26120140 |
SS00368 | hopA1 | Type III effector HopA1 (UniProt) | Pseudomonas syringae | J7I9B3 | AFQ35552.1 | 26120140 |
SS00369 | hopA1 | Type III effector HopA1 (UniProt) | Pseudomonas syringae | J7I9B7 | AFQ35557.1 | 26120140 |
SS00370 | avrE1 | Avirulence E1 effector (UniProt) | Pseudomonas syringae | J7I9E2 | AFQ35566.1 | 26120140 |
SS00371 | avrE1 | Avirulence E1 effector (UniProt) | Pseudomonas syringae | J7I9R7 | AFQ35566.1 | 26120140 |
SS00372 | hopA1 | Type III effector HopA1 (UniProt) | Pseudomonas syringae | J7I9V0 | AFQ35555.1 | 26120140 |
SS00373 | hopA1 | Type III effector HopA1 (UniProt) | Pseudomonas syringae | J7I9V5 | AFQ35559.1 | 26120140 |
SS00374 | avrE1 | Avirulence E1 effector (UniProt) | Pseudomonas syringae | J7I9W3 | AFQ35570.1 | 26120140 |
SS00375 | avrE1 | Avirulence E1 effector (UniProt) | Pseudomonas syringae | J7I9W8 | AFQ35571.1 | 26120140 |
SS00376 | avrE1 | Type III effector avirulence E1 (UniProt) | Pseudomonas syringae | J7IA88 | AFQ35566.1 | 26120140 |
SS00377 | hopA1 | Type III effector HopA1 (UniProt) | Pseudomonas syringae | J7IDH5 | AFQ35554.1 | 26120140 |
SS00378 | avrE1 | Type III effector avirulence E1 (UniProt) | Pseudomonas syringae | J7IDX1 | AFQ35669.1 | 26120140 |
SS00379 | hopA1 | Type III effector HopA1 (UniProt) | Pseudomonas syringae | J7IE52 | AFQ35759.1 | 26120140 |
SS00380 | hopA1 | Type III effector HopA1 (UniProt) | Pseudomonas syringae | J7IG74 | AFQ35553.1 | 26120140 |
SS00381 | hopA1 | Type III effector HopA1 (UniProt) | Pseudomonas syringae | J7IG80 | AFQ35558.1 | 26120140 |
SS00382 | avrE1 | Type III effector avirulence E1 (UniProt) | Pseudomonas syringae | J7IGK1 | AFQ35566.1 | 26120140 |
SS00383 | hopA1 | Type III effector HopA1 (UniProt) | Pseudomonas syringae | J7IGZ7 | AFQ35556.1 | 26120140 |
SS00384 | avrE1 | Type III effector avirulence E1 (UniProt) | Pseudomonas syringae | J7IHF0 | AFQ35671.1 | 26120140 |
SS00385 | avrE1 | Type III effector avirulence E1 (UniProt) | Pseudomonas syringae | J7IHF5 | AFQ35667.1 | 26120140 |
SS00386 | hopA1 | Type III effector HopA1 (UniProt) | Pseudomonas syringae | J7IHN8 | AFQ35551.1 | 26120140 |
SS00387 | CT143 | hypothetical protein CT_143 (NCBI) | Chlamydia trachomatis | K0GGG6 | NP_219646.1 | 26120140 |
SS00388 | ALP32_02711 | Type III effector HopAH2-2 (UniProt, NCBI) | Pseudomonas avellanae | A0A3M5TYK5 | RMU38423.1 | 26120140 |
SS00391 | ALP32_200160 | type III effector HopBB1 (NCBI) | Pseudomonas avellanae | A0A3M5TKI9 | EKG29764.1 | 26120140 |
SS00395 | ALP32_04208 | Type III effector HopH1 (UniProt, NCBI) | Pseudomonas avellanae | A0A3M5T0Y0 | RMU27201.1 | 26120140 |
SS00396 | ALP32_200347 | type III effector AvrRps4 (NCBI) | Pseudomonas avellanae | A0A3M5TXA8 | EKG29747.1 | 26120140 |
SS00397 | ALQ98_04712 | Type III effector HopX1 (UniProt, NCBI) | Pseudomonas syringae | A0A0P9SS82 | KPX63893.1 | 26120140 |
SS00398 | Pav631_4276 | HopO1-3 (UniProt) | Pseudomonas avellanae | A0A3M5TK21 | WP_005620561.1 | 26120140 |
SS00400 | ALO75_01002 | Type III effector HopAI1 (UniProt, NCBI) | Pseudomonas syringae | A0A0P9NJA0 | RMR81635.1 | 26120140 |
SS00401 | ALQ98_00963 | Type III effector HopAA1 (UniProt, NCBI) | Pseudomonas syringae | A0A3M2UBF8 | RML20861.1 | 26120140 |
SS00403 | ALP32_04288 | Type III effector HopY1 (UniProt, NCBI) | Pseudomonas avellanae | A0A3M5STQ8 | WP_005613222.1 | 26120140 |
SS00404 | CXB37_16030 | Type III effector HopBF1 (UniProt, NCBI) | Pseudomonas syringae | A0A2S4J8L5 | ALU58326.1 | 26120140 |
SS00405 | sopE | Guanine nucleotide exchange factor SopE (UniProt) | Salmonella dublin | O06949 | 26120140 | |
SS00406 | popB | PopB (UniProt, NCBI) | Pseudomonas aeruginosa | O30529 | AAC45937.1 | 24391954 |
SS00407 | IncC | Inclusion membrane protein C (UniProt, NCBI) | Chlamydia caviae | O30783 | AAC46379.1 | 19390696 |
SS00408 | sopB | Inositol phosphate phosphatase SopB (UniProt) | Salmonella enterica | O30916 | WP_001166946.1 | 23437191 |
SS00410 | copN | CopN protein (UniProt) | Chlamydia caviae | O34020 | WP_011006420.1 | 19390696 |
SS00411 | sopB | Inositol phosphate phosphatase SopB (UniProt) | Salmonella dublin | O34105 | O34105.1 | 21106126 |
SS00412 | exoU | ExoU (Reference, UniProt) | Pseudomonas aeruginosa | O34208 | WP_003134060.1 | 14500525;24391954 |
SS00413 | sopE | Guanine nucleotide exchange factor SopE (UniProt) | Salmonella typhimurium | O52623 | WP_000161707.1 | 19390696 |
SS00414 | yopT | Cysteine protease YopT (UniProt, NCBI) | Yersinia pestis | O68703 | YP_004210032.1 | 21106126 |
SS00415 | incA | Inclusion membrane protein A (UniProt, NCBI) | Chlamydia trachomatis | P0DPS5 | P0DPS5.1 | 24391954 |
SS00416 | CT_053 | hypothetical protein CT_053 (NCBI) | Chlamydia trachomatis | O84056 | 26120140 | |
SS00417 | CT_083 | hypothetical protein CT_083 (NCBI) | Chlamydia trachomatis | O84085 | NP_219586.1 | 24391954 |
SS00418 | CT_105 | hypothetical protein CT_105 (NCBI) | Chlamydia trachomatis | O84107 | NP_219608.1 | 26120140 |
SS00419 | incE | IncE (UniProt) | Chlamydia trachomatis | B7SCF5 | WP_009873571.1 | 24391954 |
SS00420 | incF | IncF (UniProt) | Chlamydia trachomatis | B7SCF6 | WP_010725072.1 | 24391954 |
SS00421 | incG | Inclusion membrane protein G (UniProt, NCBI) | Chlamydia trachomatis | P0DPS6 | WP_009871465.1 | 24391954 |
SS00422 | CT_142 | hypothetical protein CT_142 (NCBI) | Chlamydia trachomatis | O84144 | NP_219645.1 | 26120140 |
SS00423 | CT_161 | hypothetical protein CT_161 (NCBI) | Chlamydia trachomatis | O84163 | NP_219664.1 | 26120140 |
SS00424 | CT_223 | IncA family protein (NCBI) | Chlamydia trachomatis | O84226 | WP_010725128.1 | 24391954 |
SS00425 | CT_229 | hypothetical protein G11222_01175 (NCBI) | Chlamydia trachomatis | O84232 | ADH18839.1 | 24391954 |
SS00426 | incB | Inclusion Membrane Protein B (UniProt) | Chlamydia trachomatis | O84235 | WP_009871579.1 | 19390696 |
SS00427 | incC | Inclusion Membrane Protein C (UniProt, NCBI) | Chlamydia trachomatis | O84236 | WP_009871580.1 | 19390696 |
SS00428 | CT_288 | hypothetical protein CT_288 (NCBI) | Chlamydia trachomatis | O84290 | NP_219793.1 | 24391954 |
SS00429 | CT_338 | hypothetical protein CT_338 (NCBI) | Chlamydia trachomatis | O84342 | NP_219845.1 | 26120140 |
SS00430 | aaxB | Pyruvoyl-dependent arginine decarboxylase AaxB (UniProt, NCBI) | Chlamydia trachomatis | O84378 | WP_010725175.1 | 24391954 |
SS00431 | CT_429 | UPF0158 protein CT_429 (UniProt) | Chlamydia trachomatis | O84436 | NP_219941.1 | 26120140 |
SS00432 | srp | Sulfur-rich protein, serovar D (UniProt) | Chlamydia trachomatis | O84449 | NP_219954.1 | 24391954 |
SS00433 | tarP | type III secretion system actin-recruiting effector Tarp (NCBI) | Chlamydia trachomatis | O84462 | WP_010725202.1 | 19390696 |
SS00434 | CT_529 | hypothetical protein CT_529 (NCBI) | Chlamydia trachomatis | O84534 | NP_220044.1 | 24391954 |
SS00435 | CT_550 | hypothetical protein CT_550 (NCBI) | Chlamydia trachomatis | O84554 | NP_220065.1 | 24391954 |
SS00436 | CT_610 | Probable oxidoreductase CT_610 (NCBI) | Chlamydia trachomatis | O84616 | O84616.1 | 24391954 |
SS00437 | CT_618 | hypothetical protein CT_618 (NCBI) | Chlamydia trachomatis | O84623 | NP_220135.1 | 24391954 |
SS00438 | CT_620 | hypothetical protein CT_620 (NCBI) | Chlamydia trachomatis | O84625 | NP_220137.1 | 26120140 |
SS00439 | CT_621 | hypothetical protein CT_621 (NCBI) | Chlamydia trachomatis | O84626 | NP_220138.1 | 23437191 |
SS00440 | CT_642 | hypothetical protein CT_642 (NCBI) | Chlamydia trachomatis | O84648 | NP_220160.1 | 24391954 |
SS00441 | CT_694 | hypothetical protein CT_694 (NCBI) | Chlamydia trachomatis | O84700 | NP_220213.1 | 23437191 |
SS00442 | CT_712 | Hypothetical protein CTDEC_0712 (NCBI) | Chlamydia trachomatis | O84718 | ADI51389.1 | 24391954 |
SS00443 | CT_718 | Chlamydia trachomatis | O84723 | 24391954 | ||
SS00444 | yycJ | ribonuclease Z (NCBI) | Chlamydia trachomatis | O84743 | CCP48136.1 | 24391954 |
SS00445 | CT_847 | hypothetical protein CT_847 (NCBI) | Chlamydia trachomatis | O84854 | NP_220368.1 | 24391954 |
SS00446 | CT_848 | hypothetical protein CT_848 (NCBI) | Chlamydia trachomatis | O84855 | NP_220369.1 | 24391954 |
SS00447 | CT_849 | hypothetical protein CT_849 (NCBI) | Chlamydia trachomatis | O84856 | NP_220370.1 | 26120140 |
SS00448 | CT_861 | type III secretion system translocon subunit CopB2 (NCBI) | Chlamydia trachomatis | O84869 | WP_010725374.1 | 23437191 |
SS00449 | CT_863 | hypothetical protein CT_863 (NCBI) | Chlamydia trachomatis | O84871 | NP_220385.1 | 24391954 |
SS00450 | CT_875 | hypothetical protein CT_875 (NCBI) | Chlamydia trachomatis | O84883 | NP_219502.1 | 26120140 |
SS00451 | sseA | Type III secretion system chaperone SseA (UniProt) | Salmonella enterica | O84944 | WP_001738219.1 | 23437191 |
SS00452 | sseC | Secreted effector protein SseC (UniProt) | Salmonella enterica | O84947 | WP_001079760.1 | 23437191 |
SS00453 | sseE | Pathogenicity island 2 effector protein SseE (UniProt) | Salmonella enterica | O84949 | WP_000249606.1 | 24391954 |
SS00454 | sseF | Pathogenicity island 2 effector protein SseF (UniProt, NCBI) | Salmonella enterica | O84951 | NP_460369.1 | 23437191 |
SS00455 | sseG | Pathogenicity island 2 effector protein SseG (UniProt, NCBI) | Salmonella enterica | O84952 | AGK08283.1 | 23437191 |
SS00456 | hrcQb | Type III secretion protein HrcQb (UniProt, NCBI) | Pseudomonas savastanoi | O85094 | WP_004666088.1 | |
SS00457 | yopO | Protein kinase YopO (UniProt, NCBI) | Yersinia enterocolitica | O85239 | NP_052380.1 | 19390696 |
SS00458 | exoY | type III secretion system adenylate cyclase effector ExoY (NCBI) | Pseudomonas aeruginosa | O85345 | WP_016263503.1 | 19680249 |
SS00459 | espG | EspG (UniProt) | Escherichia coli | O85646 | ASE48005.1 | 19390696 |
SS00460 | pthG | PthG (UniProt, NCBI) | Pantoea agglomerans | O85666 | AAC24862.2 | 24391954 |
SS00461 | hrpW | type III effector HrpK (NCBI) | Pseudomonas syringae | O87327 | KTB81138.1 | 24391954 |
SS00462 | hrpZ | Harpin HrpZ (UniProt, NCBI) | Pseudomonas syringae | O87653 | O87653.1 | 24391954 |
SS00463 | yopE | Outer membrane virulence protein YopE (UniProt) | Pseudomonas fluorescens | P08008 | WP_002229754.1 | 26120140 |
SS00464 | yopH | Tyrosine-protein phosphatase YopH (UniProt) | Yersinia pseudotuberculosis serotype I | P08538 | WP_002213278.1 | 23437191 |
SS00465 | spaN | Surface presentation of antigens protein SpaN (UniProt) | Shigella flexneri | P0A1K5 | NP_858284.1 | 23437191 |
SS00466 | spvC | type III secretion system effector phosphothreonine lyase SpvC (NCBI) | Salmonella enterica | P0A2M9 | WP_001122242.1 | 24391954 |
SS00467 | map | Methionine aminopeptidase (UniProt) | Escherichia coli | P0AE20 | WP_001018194.1 | 24391954 |
SS00468 | yopT1 | Cysteine protease yopT1 (UniProt) | Yersinia enterocolitica | P0C2N1 | WP_005176719.1 | 19390696 |
SS00469 | yscX | Yop proteins translocation protein X (UniProt) | Yersinia enterocolitica | P0C2N4 | WP_002212969.1 | |
SS00470 | sspH2 | E3 ubiquitin-protein ligase sspH2 (UniProt) | Salmonella enterica | P0CE12 | WP_001115840.1 | 19390696 |
SS00471 | incA | Inclusion membrane protein A (UniProt) | Chlamydia trachomatis | P0CI27 | ||
SS00472 | sipC | Cell invasion protein SipC (UniProt) | Salmonella enterica | P0CL47 | WP_000909019.1 | 23437191 |
SS00473 | sipA | Cell invasion protein SipA (UniProt) | Salmonella enterica | P0CL52 | WP_000258811.1 | 19390696 |
SS00474 | spiC | Salmonella pathogenicity island 2 protein C (UniProt) | Salmonella enterica | P0CZ04 | WP_001738217.1 | 26120140 |
SS00475 | espF(U) | Secreted effector protein EspF(U) (UniProt) | Escherichia coli | P0DJ88 | WP_010917831.1 | 19390696 |
SS00476 | espF(U) | Secreted effector protein EspF(U) (UniProt) | Escherichia coli | P0DJ89 | WP_010917831.1 | 19390696 |
SS00477 | incD | inclusion membrane protein IncD (NCBI) | Chlamydia trachomatis | P0DJI3 | WP_009871462.1 | 19390696 |
SS00478 | incE | inclusion membrane protein IncE (NCBI) | Chlamydia trachomatis | P0DJI4 | WP_010725071.1 | 19390696 |
SS00479 | incF | inclusion membrane protein IncF (NCBI) | Chlamydia trachomatis | P0DJI5 | WP_010725072.1 | 19390696 |
SS00480 | avrA | Avirulence protein A (UniProt, NCBI) | Pseudomonas savastanoi | P11437 | P11437.1 | 19390696 |
SS00481 | avrB | Avirulence protein B (UniProt, NCBI) | Pseudomonas savastanoi | P13835 | P13835.1 | 19390696 |
SS00482 | avrBs3 | Avirulence protein AvrBs3 (UniProt) | Xanthomonas euvesicatoria | P14727 | P14727.2 | 24391954 |
SS00483 | yopH | Tyrosine-protein phosphatase YopH (UniProt) | Yersinia enterocolitica | P15273 | WP_010891234.1 | 26120140 |
SS00484 | yopM | Outer membrane protein YopM (UniProt) | Yersinia pestis | P17778 | WP_002229779.1 | 26120140 |
SS00485 | ipaH4.5 | Probable E3 ubiquitin-protein ligase ipaH4.5 (UniProt) | Shigella flexneri | P18009 | WP_010921638.1 | 26120140 |
SS00486 | ipaA | Invasin IpaA (UniProt, NCBI) | Shigella flexneri | P18010 | EGK22689.1 | 23437191 |
SS00487 | ipaB | Invasin IpaB (UniProt) | Shigella flexneri | P18011 | WP_010921663.1 | 23437191 |
SS00488 | ipaC | Invasin IpaC (UniProt) | Shigella flexneri | P18012 | WP_031942475.1 | 23437191 |
SS00489 | ipaD | Invasin IpaD (UniProt) | Shigella flexneri | P18013 | WP_010921661.1 | 23437191 |
SS00490 | ipaH7.8 | Probable E3 ubiquitin-protein ligase ipaH7.8 (UniProt) | Shigella flexneri | P18014 | WP_010921637.1 | 26120140 |
SS00491 | Uncharacterized 12.2 kDa protein in lcrE 5'region (UniProt, NCBI) | Yersinia enterocolitica | P21211 | P21211.1 | ||
SS00492 | yopQ | Protein YopQ (UniProt, NCBI) | Yersinia enterocolitica | P27474 | P27474.1 | 23437191 |
SS00493 | yopT | Cysteine protease YopT (UniProt) | Yersinia enterocolitica | P27475 | WP_010891203.1 | 19390696 |
SS00494 | sodA | Superoxide dismutase [Mn] (UniProt) | Listeria monocytogenes | P28764 | WP_003721944.1 | 24391954 |
SS00495 | yopE | Outer membrane virulence protein YopE (UniProt) | Yersinia enterocolitica | P31492 | WP_010891237.1 | 26120140 |
SS00496 | yopE | Outer membrane virulence protein YopE (UniProt, NCBI) | Yersinia pestis | P31493 | YP_004210019.1 | 23437191 |
SS00497 | yopJ | Effector protein YopJ (UniProt) | Pseudomonas fluorescens | P31498 | WP_002225474.1 | 26120140 |
SS00498 | nolB | Nodulation protein NolB (UniProt, NCBI) | Rhizobium fredii | P33208 | WP_014857557.1 | 23437191 |
SS00499 | icsB | Virulence protein IcsB (UniProt) | Shigella flexneri | P33546 | WP_010921665.1 | 24391954 |
SS00500 | ipgB | Protein IpgB (UniProt) | Shigella flexneri | P33548 | ADA76868.1 | 24391954 |
SS00501 | hrpZ | Harpin HrpZ (UniProt, NCBI) | Pseudomonas syringae | P35674 | WP_003433477.1 | |
SS00502 | yopB | Protein YopB (UniProt) | Yersinia enterocolitica | P37131 | WP_010891208.1 | 24391954 |
SS00503 | yopD | Protein YopD (UniProt) | Yersinia enterocolitica | P37132 | WP_010891207.1 | 24391954 |
SS00504 | yscQ | Yop proteins translocation protein Q (UniProt) | Pseudomonas fluorescens | P40296 | WP_054105001.1 | |
SS00505 | spaN | Surface presentation of antigens protein SpaN (UniProt, NCBI) | Salmonella enterica | P40613 | P40613.1 | 19390696 |
SS00506 | spaO | Surface presentation of antigens protein SpaO (UniProt) | Salmonella enterica | P40699 | EAN3830061.1 | |
SS00507 | sopD | Secreted effector protein SopD (UniProt) | Salmonella enterica | P40722 | KMJ26268.1 | 19390696 |
SS00508 | yscQ | Yop proteins translocation protein Q (UniProt) | Yersinia pestis | P42713 | WP_054105001.1 | |
SS00509 | NGR_a03640 | NopM (Reference); Probable E3 ubiquitin-protein ligase NGR_a03640 (UniProt) | Rhizobium fredii | P55456 | AAB91674.1 | 22615567 |
SS00510 | NGR_a02610 | type III secretion system YopJ family effector NopJ (NCBI) | Rhizobium fredii | P55555 | WP_010875286.1 | 24391954 |
SS00511 | nopL | Nodulation outer protein L (UniProt) | Rhizobium fredii | P55704 | 23437191 | |
SS00512 | nopX | Nodulation outer protein X (UniProt) | Rhizobium fredii | P55711 | WP_010875111.1 | 23437191 |
SS00513 | nolB | Nodulation protein NolB (UniProt, NCBI) | Rhizobium fredii | P55713 | WP_010875109.1 | 26120140 |
SS00514 | nopP | NopP (Reference); Effector protein NopP (UniProt) | Rhizobium fredii | P55724 | WP_010875098.1 | 15231809;24391954 |
SS00515 | NGR_a00490 | Putative cysteine protease YopT-like y4zC (UniProt) | Rhizobium fredii | P55730 | WP_010875091.1 | 24391954 |
SS00516 | yscH | Yop proteins translocation protein H (UniProt) | Yersinia pestis | P68590 | NP_857725.1 | 26120140 |
SS00517 | yscM | Yop proteins translocation protein M (UniProt) | Yersinia pestis | P69978 | WP_002212907.1 | 24391954 |
SS00518 | sipA | Cell invasion protein SipA (UniProt) | Salmonella enterica | P74849 | WP_000258814.1 | 24391954 |
SS00519 | sptP | Secreted effector protein SptP (UniProt) | Salmonella enterica | P74851 | WP_000946989.1 | 24391954 |
SS00520 | spiC | Salmonella pathogenicity island 2 protein C (UniProt) | Salmonella enterica | A0A0W4EPV0 | NP_460358.1 | 24391954 |
SS00521 | sptP | Secreted effector protein SptP (UniProt) | Salmonella enterica | P74873 | WP_000922300.1 | 19390696 |
SS00522 | yopM | Yop effector YopM (UniProt, NCBI) | Yersinia enterocolitica | P74988 | NP_052388.1 | 26120140 |
SS00523 | hrpN | Harpin HrpN (UniProt) | Erwinia amylovora | Q01099 | WP_004155369.1 | 24391954 |
SS00524 | mxiC | Protein MxiC (UniProt) | Shigella flexneri | Q04640 | WP_010921674.1 | 23437191 |
SS00525 | eaeB | Protein EaeB (UniProt) | Escherichia coli | Q05129 | WP_001091991.1 | 26120140 |
SS00526 | ypkA | Protein kinase YpkA (UniProt) | Pseudomonas fluorescens | Q05608 | 19390696 | |
SS00527 | avrBs4 | Avirulence protein avrBs4 (UniProt, NCBI) | Xanthomonas vesicatoria | Q07061 | CAA48680.1 | 23437191 |
SS00528 | ipgD | Inositol phosphate phosphatase IpgD (UniProt) | Shigella flexneri | Q07566 | YP_009062490.1 | 23437191 |
SS00529 | avrP | Chain A, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto (NCBI) | Pseudomonas syringae | Q08242 | 2QKW_A | 24391954 |
SS00530 | hrmA | Protein HrmA (UniProt, NCBI) | Pseudomonas syringae | Q08370 | Q08370.1 | 19390696 |
SS00531 | avrRxv | Avirulence protein AvrRxv (UniProt) | Xanthomonas euvesicatoria | Q08678 | WP_011346137.1 | 23437191 |
SS00532 | popC | PopC (UniProt, NCBI) | Xanthomonas oryzae | Q156B7 | ABG23671.1 | 26120140 |
SS00533 | exoU | type III secretion system effector cytotoxin ExoU (NCBI) | Pseudomonas aeruginosa | Q1W4Y8 | WP_023098783.1 | 26120140 |
SS00534 | aopO | Salmonella pathogenicity island 2 protein C (UniProt) | Aeromonas salmonicida | Q27RI0 | WP_005321178.1 | 26120140 |
SS00535 | aopH | AopH (UniProt) | Aeromonas salmonicida | Q27RI1 | WP_011899483.1 | 26120140 |
SS00536 | HrpY (UniProt, NCBI) | Acidovorax avenae | Q2AC60 | BAE80275.1 | 26120140 | |
SS00537 | ospF | Phosphothreonine lyase OspF (UniProt, NCBI) | Shigella dysenteriae | Q2ET08 | Q2ET08.1 | 26120140 |
SS00538 | ospF | Phosphothreonine lyase OspF (UniProt, NCBI) | Shigella boydii | Q2ET28 | Q2ET08.1 | 26120140 |
SS00539 | tccP | Tir-cytoskeleton coupling protein (UniProt. NCBI) | Escherichia coli | Q2F7Y9 | ABB16333.1 | 26120140 |
SS00540 | tir | Translocated intimin receptor (UniProt) | Escherichia coli | Q2F7Z0 | WP_024223567.1 | 26120140 |
SS00541 | sipB | Cell invasion protein SipB (NCBI) | Sodalis glossinidius | Q2NVH6 | AAS66851.1 | 24391954 |
SS00542 | hopAB3 | Effector protein HopAB3 (UniProt) | Pseudomonas syringae | Q2QCI9 | Q2QCI9.1 | 24391954 |
SS00543 | STM2137 | Putative cytoplasmic protein (UniProt) | Salmonella enterica | Q2QHF9 | AAZ76144.1 | 26120140 |
SS00544 | bopA | Effector protein BopA (UniProt) | Burkholderia thailandensis | Q2T703 | WP_011401050.1 | 21106126 |
SS00545 | bopE | Guanine nucleotide exchange factor BopE (UniProt, NCBI) | Burkholderia thailandensis | Q2T704 | WP_009896161.1 | 21106126 |
SS00546 | bipD | Translocator protein BipD (UniProt) | Burkholderia thailandensis | Q2T708 | WP_025404166.1 | |
SS00547 | bipC | Effector protein BipC (UniProt) | Burkholderia thailandensis | Q2T710 | WP_009896151.1 | 26120140 |
SS00548 | bipB | Translocator protein BipB (UniProt) | Burkholderia thailandensis | Q2T711 | WP_011401047.1 | |
SS00549 | ipaH9.8 | E3 ubiquitin-protein ligase ipaH9.8 (UniProt) | Shigella boydii | Q31SH3 | WP_000936800.1 | |
SS00550 | ospF | Phosphothreonine lyase OspF (UniProt, NCBI) | Shigella boydii | Q31SR9 | Q31SR9.1 | 26120140 |
SS00551 | virA | Cysteine protease-like VirA (UniProt) | Shigella dysenteriae | Q326N4 | AHA69218.1 | 24391954 |
SS00552 | ipgB1 | IpgB1 (UniProt) | Shigella dysenteriae | Q326S7 | WP_001166524.1 | 23437191 |
SS00553 | ipaJ | IpaJ (UniProt) | Shigella dysenteriae | Q326T5 | SPZ80070.1 | 23437191 |
SS00554 | ipaH9.8 | E3 ubiquitin-protein ligase ipaH9.8 (UniProt) | Shigella dysenteriae | Q326Z6 | WP_000936809.1 | |
SS00555 | ospC1 | OspC1 (UniProt) | Shigella dysenteriae | Q327E0 | WP_011379035.1 | 23437191 |
SS00556 | ospF | Phosphothreonine lyase OspF (UniProt, NCBI) | Shigella dysenteriae | Q327I2 | Q327I2.1 | 26120140 |
SS00557 | ospB | OspB (UniProt, NCBI) | Shigella dysenteriae | Q327J1 | WP_011379054.1 | 23437191 |
SS00558 | xopQ | Xanthomonas outer protein Q (UniProt) | Xanthomonas campestris | Q3BM44 | AAV74206.1 | 24391954 |
SS00559 | xopN | Xanthomonas outer protein N (UniProt) | Xanthomonas campestris | Q3BRD8 | AAV74202.1 | 24391954 |
SS00560 | xopF2 | Xanthomonas outer protein F2 (UniProt) | Xanthomonas campestris | Q3BRE0 | CAJ24621.1 | 24391954 |
SS00561 | xopC | Xanthomonas outer protein C (UniProt) | Xanthomonas campestris | Q3BSU7 | AAR23832.1 | 24391954 |
SS00562 | xopJ | Xanthomonas outer protein J (UniProt) | Xanthomonas campestris | Q3BTM6 | WP_011347382.1 | 24391954 |
SS00563 | xopP | Xanthomonas outer protein P (UniProt) | Xanthomonas campestris | Q3BW96 | AAV74208.1 | 24391954 |
SS00564 | xopO | Xanthomonas outer protein O (UniProt, NCBI) | Xanthomonas campestris | Q3BWS7 | WP_011346566.1 | 24391954 |
SS00565 | xopB | Xanthomonas outer protein B (UniProt, NCBI) | Xanthomonas campestris | Q3BY51 | CAJ22212.1 | 24391954 |
SS00566 | xopX | Xanthomonas outer protein X (UniProt) | Xanthomonas campestris | Q3BY60 | AOY68224.1 | 24391954 |
SS00567 | avrRxv | Avirulence protein AvrRxv (UniProt) | Xanthomonas campestris | Q3BYG1 | WP_011346137.1 | 24391954 |
SS00568 | xopD | Xanthomonas outer protein D (UniProt) | Xanthomonas campestris | Q3BYJ5 | CAJ22068.1 | 24391954 |
SS00569 | xopF1 | Xanthomonas outer protein F1 (UniProt) | Xanthomonas campestris | Q3BYL8 | WP_011346095.1 | 24391954 |
SS00570 | avrBs1 | Avirulence protein AvrBs1 (UniProt) | Xanthomonas campestris | Q3C000 | CAJ19916.1 | 23437191 |
SS00571 | bipB | Translocator protein BipB (UniProt) | Burkholderia pseudomallei | Q3JL23 | WP_004528817.1 | |
SS00572 | bipC | Effector protein BipC (UniProt) | Burkholderia pseudomallei | Q3JL24 | WP_004528816.1 | 21106126 |
SS00573 | bipD | Translocator protein BipD (UniProt) | Burkholderia pseudomallei | Q3JL26 | WP_004188590.1 | |
SS00574 | bopE | Guanine nucleotide exchange factor BopE (UniProt, NCBI) | Burkholderia pseudomallei | Q3JL30 | WP_004528812.1 | 21106126 |
SS00575 | bopA | Effector protein BopA (UniProt) | Burkholderia pseudomallei | Q3JL32 | WP_004528810.1 | 26120140 |
SS00576 | ipaH9.8 | E3 ubiquitin-protein ligase ipaH9.8 (UniProt) | Shigella sonnei | Q3YTH5 | WP_000936807.1 | |
SS00577 | virA | Cysteine protease-like VirA (UniProt, NCBI) | Shigella sonnei | Q3YTK0 | Q3YTK0.1 | 21106126 |
SS00578 | mxiL | MxiL (UniProt, NCBI) | Shigella sonnei | Q3YTN8 | AAZ91124.1 | 23437191 |
SS00579 | ospF | Phosphothreonine lyase OspF (UniProt) | Shigella sonnei | Q3YTY3 | AAZ91029.1 | 26120140 |
SS00580 | incA | inclusion membrane protein A (NCBI) | Chlamydia caviae | Q46210 | AAP05293.1 | 19390696 |
SS00581 | espA | EspA (UniProt) | Escherichia coli | Q47184 | WP_000381567.1 | 25645555 |
SS00582 | hrpN | Harpin HrpN (UniProt) | Dickeya chrysanthemi | Q47278 | WP_040001177.1 | 24391954 |
SS00583 | hopAB1 | Effector protein hopAB1 (UniProt, NCBI) | Pseudomonas savastanoi | Q48B61 | Q48B61.1 | 19390696 |
SS00584 | avrD1 | Syringolide biosynthetic protein AvrD1 (UniProt, NCBI) | Pseudomonas savastanoi | Q48B68 | AAZ37987.1 | 23437191 |
SS00585 | avrRps4 | Type III effector AvrRps4 (UniProt, NCBI) | Pseudomonas savastanoi | Q48B92 | AAZ38042.1 | 26120140 |
SS00586 | hopAU1 | Type III effector HopAU1 (UniProt, NCBI) | Pseudomonas savastanoi | Q48BC6 | AAX12110.1 | 26120140 |
SS00587 | hopD1 | Type III effector HopD1 (UniProt) | Pseudomonas savastanoi | Q48BE0 | WP_011282444.1 | 19390696 |
SS00588 | hopI1 | Type III effector HopI1 (UniProt, NCBI) | Pseudomonas savastanoi | Q48DQ9 | AAZ33342.1 | 26120140 |
SS00589 | hopAE1 | Effector protein hopAE1 (UniProt, NCBI) | Pseudomonas savastanoi | Q48DU8 | Q48DU8.1 | 24391954 |
SS00590 | hopX1 | Type III effector HopX1 (UniProt, NCBI) | Pseudomonas savastanoi | Q48M17 | AAZ37209.1 | 26120140 |
SS00591 | avrE1 | Type III effector AvrE1 (UniProt, NCBI) | Pseudomonas savastanoi | Q48M45 | AAZ34169.1 | 26120140 |
SS00592 | eseD | Type III secretion system effector protein D (UniProt) | Edwardsiella tarda | Q4ACE6 | BAE19884.1 | 26120140 |
SS00593 | eseB | EseB (UniProt, NCBI) | Edwardsiella tarda | Q4G4C8 | ADM40935.1 | 24391954 |
SS00594 | eseC | EseC (UniProt, NCBI) | Edwardsiella tarda | Q4G4D0 | AAV69404.1 | 23437191 |
SS00595 | eseD | EseD (UniProt, NCBI) | Edwardsiella tarda | Q4G4D1 | AAV69405.1 | 26120140 |
SS00596 | hopAB1 | Effector protein hopAB1 (UniProt, NCBI) | Pseudomonas syringae | Q4ZMD6 | WP_011269154.1 | 26120140 |
SS00597 | Psyr_4326 | Type III effector HopI1 (UniProt, NCBI) | Pseudomonas syringae | Q4ZNB6 | RMR49188.1 | 26120140 |
SS00598 | Psyr_1889 | Type III effector HopH1 (UniProt, NCBI) | Pseudomonas syringae | Q4ZV89 | AAY36933.1 | 26120140 |
SS00599 | Psyr_1224 | Type III effector HopZ3 (UniProt) | Pseudomonas syringae | Q4ZX47 | WP_011266899.1 | 26120140 |
SS00600 | Psyr_1220 | Type III effector HopX1 (UniProt, NCBI) | Pseudomonas syringae | Q4ZX48 | AAY36274.1 | 26120140 |
SS00601 | Psyr_1188 | Type III effector protein AvrE1 (UniProt, NCBI) | Pseudomonas syringae | Q4ZX80 | AAY36242.1 | 26120140 |
SS00602 | hopM1 | Effector protein hopM1 (UniProt, NCBI) | Pseudomonas syringae | Q4ZX82 | PYD11074.1 | 24391954 |
SS00603 | Psyr_1183 | Type III effector HopAA1 (UniProt, NCBI) | Pseudomonas syringae | Q4ZX85 | AAY36237.1 | 26120140 |
SS00604 | Psyr_1017 | Type III effector HopJ1 (UniProt, NCBI) | Pseudomonas syringae | Q4ZXP9 | AAY36073.1 | 24391954 |
SS00605 | Psyr_0738 | Type III effector protein AvrRpm1 (UniProt, NCBI) | Pseudomonas syringae | Q4ZYH0 | WP_011266597.1 | 23437191 |
SS00606 | nopP | NopP (UniProt, NCBI) | Rhizobium fredii | Q50EL2 | AAY33495.1 | 23437191 |
SS00607 | exoS | Exoenzyme S (UniProt, NCBI) | Pseudomonas aeruginosa | Q51451 | CAA67834.1 | 19680249 |
SS00608 | Uncharacterized protein (UniProt) | Pseudomonas syringae | Q52389 | AAC43431.1 | 19390696 | |
SS00609 | avrPphE | AvrPphE (UniProt, NCBI) | Pseudomonas savastanoi | Q52394 | KPB61822.1 | 19390696 |
SS00611 | avrPph3 | Cysteine protease avirulence protein AvrPphB (UniProt, NCBI) | Pseudomonas savastanoi | Q52430 | Q52430.1 | 24391954 |
SS00612 | avrRps4 | Avirulence protein (UniProt) | Pseudomonas syringae | Q52432 | AAB51082.1 | 19390696 |
SS00614 | hrpA | Hrp pili protein HrpA (UniProt, NCBI) | Pseudomonas savastanoi | Q52480 | Q52480.1 | |
SS00615 | hrpZ | HrpZ (Reference); Harpin HrpZ (UniProt) | Pseudomonas savastanoi | Q52481 | RMN11121.1 | 11953310 |
SS00616 | hrpC | HrpC protein (UniProt, NCBI) | Ralstonia solanacearum | Q52497 | CAB58259.1 | 24391954 |
SS00617 | avrD | Avirulence gene D (UniProt) | Pseudomonas savastanoi | Q52530 | AAA20579.2 | 19390696 |
SS00618 | avrPmaA1 | AvrPmaA1 protein (UniProt) | Pseudomonas syringae | Q52537 | CAA48009.1 | 24391954 |
SS00619 | ipgD | Inositol phosphate phosphatase IpgD (UniProt, NCBI) | Shigella sonnei | Q55286 | EJL18802.1 | 21106126 |
SS00620 | sipB | Cell invasion protein SipB (UniProt) | Salmonella enterica | Q56019 | EAM2495865.1 | 26120140 |
SS00621 | sipC | SPI-1 type III secretion system needle tip complex protein SipC (UniProt, NCBI) | Salmonella enterica | A0A059QAM0 | WP_000909019.1 | 24391954 |
SS00622 | sipD | Cell invasion protein SipD (UniProt) | Salmonella enterica | Q56026 | EAX9274794.1 | 24391954 |
SS00623 | sipA | SPI-1 type III secretion system effector SipA (UniProt) | Salmonella enterica | A0A0W4JE17 | E1WAC6.1 | 21106126 |
SS00624 | sifA | Secreted effector protein SifA (UniProt) | Salmonella enterica | Q56061 | WP_094889292.1 | 19390696 |
SS00625 | sipB | Cell invasion protein SipB (UniProt) | Salmonella enterica | Q56134 | AKD16728.1 | 24391954 |
SS00626 | sipC | Cell invasion protein SipC (UniProt) | Salmonella enterica | Q56135 | WP_000909023.1 | 21106126 |
SS00627 | ypkA | Protein kinase A (UniProt) | Yersinia enterocolitica | Q56921 | 19390696 | |
SS00628 | yopK | YopK (UniProt) | Yersinia pseudotuberculosis | Q56935 | 19390696 | |
SS00629 | pipB2 | Secreted effector protein PipB2 (UniProt) | Salmonella enterica | Q57KZ6 | WP_001540738.1 | 24391954 |
SS00630 | sseL | Deubiquitinase SseL (UniProt) | Salmonella enterica | Q57M66 | WP_011264333.1 | 26120140 |
SS00631 | sopA | E3 ubiquitin-protein ligase SopA (UniProt) | Salmonella enterica | Q57MS9 | Q57MS9.2 | |
SS00632 | sifB | Translocated effector SifB (UniProt, NCBI) | Salmonella enterica | Q57P56 | AAX65505.1 | 26120140 |
SS00633 | sseE | Secretion system effector SseE (UniProt) | Salmonella enterica | Q57PN2 | WP_000249606.1 | 23437191 |
SS00634 | ssaB | Secretion system apparatus SsaB (UniProt) | Salmonella enterica | Q57PP1 | AKW02830.2 | 23437191 |
SS00635 | sopB | SPI-1 type III secretion system effector inositol phosphate phosphatase SopB (NCBI) | Salmonella enterica | Q57QR2 | AJQ69097.1 | 19390696 |
SS00636 | tir | type III secretion system LEE translocated intimin receptor Tir (NCBI) | Escherichia coli | Q58I88 | WP_024240337.1 | 19390696 |
SS00637 | Type III effector HopAU1 (UniProt, NCBI) | Pseudomonas savastanoi | Q5DI80 | AAX12110.1 | 26120140 | |
SS00638 | ecf | Early chlorosis factor protein (UniProt, NCBI) | Xanthomonas euvesicatoria | Q5EN61 | AAW88576.1 | 23437191 |
SS00639 | sptP | Secreted effector protein SptP (UniProt) | Salmonella enterica | Q5PEA9 | WP_000946993.1 | 26120140 |
SS00640 | pipB2 | Secreted effector protein PipB2 (UniProt) | Salmonella enterica | Q5PEX4 | WP_011233153.1 | 26120140 |
SS00641 | sopE | Guanine nucleotide exchange factor SopE (UniProt) | Salmonella enterica | Q5PFI5 | WP_000161709.1 | 26120140 |
SS00642 | sopE2 | Guanine nucleotide exchange factor sopE2 (UniProt) | Salmonella enterica | Q5PHN0 | WP_001284212.1 | 21106126 |
SS00643 | sseL | Deubiquitinase SseL (UniProt) | Salmonella enterica | Q5PI48 | WP_001017746.1 | 26120140 |
SS00644 | xopP | XopP (UniProt) | Xanthomonas euvesicatoria | Q5QA86 | CAJ22867.1 | 23437191 |
SS00645 | xopQ | XopQ (UniProt, NCBI) | Xanthomonas euvesicatoria | Q5QA88 | AAV74206.1 | 26120140 |
SS00646 | xopF2 | XopF2 (UniProt) | Xanthomonas euvesicatoria | Q5QA89 | CAJ24621.1 | 23437191 |
SS00647 | xopN | XopN (UniProt, NCBI) | Xanthomonas euvesicatoria | Q5QA92 | AAV74202.1 | 23437191 |
SS00648 | XopF1 | hypothetical protein BHE83_17005 (NCBI) | Xanthomonas euvesicatoria | Q5RJF5 | AOY68086.1 | 23437191 |
SS00649 | aopB | AopB (UniProt, NCBI) | Aeromonas hydrophila | Q5XL02 | AAV30235.1 | 26120140 |
SS00650 | nleE | NleE (UniProt) | Citrobacter rodentium | Q5XMK7 | WP_012905390.1 | 26120140 |
SS00651 | nopX | Nodulation protein (UniProt, NCBI) | Rhizobium fredii | Q5Y4S2 | AAU85363.1 | 26120140 |
SS00652 | hrcQb | Type III secretion protein HrcQb (UniProt, NCBI) | Pseudomonas syringae | Q60235 | Q60235.1 | |
SS00653 | hrpW | Harpin secretion protein HrpW (UniProt, NCBI) | Pseudomonas syringae | Q60236 | Q60236.1 | 24391954 |
SS00654 | bipB | Translocator protein BipB (UniProt, NCBI) | Burkholderia mallei | Q62B07 | A2S1Q0.1 | |
SS00655 | bipC | Effector protein BipC (UniProt) | Burkholderia mallei | Q62B08 | WP_004203135.1 | |
SS00656 | bipD | Translocator protein BipD (UniProt, NCBI) | Burkholderia mallei | Q62B10 | A2S1Q3.1 | |
SS00657 | bopE | Guanine nucleotide exchange factor BopE (UniProt, NCBI) | Burkholderia mallei | Q62B14 | A2S1Q7.1 | 21106126 |
SS00658 | bopA | Effector protein BopA (UniProt) | Burkholderia mallei | Q62B16 | WP_004187505.1 | 26120140 |
SS00659 | bipB | Translocator protein BipB (UniProt, NCBI) | Burkholderia pseudomallei | Q63K34 | A2S1Q0.1 | 23437191 |
SS00660 | bipC | Effector protein BipC (UniProt) | Burkholderia pseudomallei | Q63K35 | WP_004203135.1 | 23437191 |
SS00662 | BPSS1528 | type 3 secretion system effector BapA (NCBI) | Burkholderia pseudomallei | Q63K38 | WP_011205636.1 | 24391954 |
SS00663 | bapC | type 3 secretion system effector BapC (NCBI) | Burkholderia pseudomallei | Q63K40 | WP_004188424.1 | 24391954 |
SS00664 | bopE | Guanine nucleotide exchange factor BopE (UniProt, NCBI) | Burkholderia pseudomallei | Q63K41 | A3NLC8.1 | 23437191 |
SS00665 | bopA | Effector protein BopA (UniProt) | Burkholderia pseudomallei | Q63K42 | WP_004528810.1 | |
SS00666 | BPSS1516 | Uncharacterized protein (UniProt) | Burkholderia pseudomallei | Q63K50 | 26120140 | |
SS00667 | yscH | Yop proteins translocation protein H (UniProt) | Pseudomonas fluorescens | Q663I2 | WP_011191390.1 | 19390696 |
SS00668 | pYV0047 | YopM putative targeted effector protein (UniProt) | Pseudomonas fluorescens | Q663L9 | WP_011191377.1 | 19390696 |
SS00669 | rip19 | TAL effector protein Rip19 (UniProt) | Ralstonia solanacearum | Q68A49 | AOE93173.1 | |
SS00670 | aopB | AopB (UniProt, NCBI) | Aeromonas hydrophila | Q699Q8 | AAS91821.1 | 26120140 |
SS00671 | xopX | Effector protein (UniProt) | Xanthomonas euvesicatoria | Q6IV70 | AOY68224.1 | 23437191 |
SS00672 | hopW1-2 | Putative truncated effector protein hopW1-2 (UniProt, NCBI) | Pseudomonas syringae | Q6J2E6 | Q6J2E6.1 | 26120140 |
SS00673 | avrRpt2 | Cysteine protease avirulence protein AvrRpt2 (UniProt, NCBI) | Pseudomonas syringae | Q6LAD6 | WP_081012136.1 | 24391954 |
SS00674 | vopJ | type III secretion system YopJ family effector VopA (NCBI) | Vibrio parahaemolyticus | Q6PLD0 | WP_015313492.1 | 24391954 |
SS00675 | nleF | Non-LEE-encoded type III effector F (UniProt) | Citrobacter rodentium | Q6Q513 | CBG91573.1 | 24391954 |
SS00676 | yspA | YspA (UniProt, NCBI) | Sodalis glossinidius | Q6R8C3 | AAS66853.1 | 24391954 |
SS00677 | yspB | YspB (UniProt, NCBI) | Sodalis glossinidius | Q6R8C5 | AAS66851.1 | 26120140 |
SS00678 | dspE | DspE (UniProt) | Pectobacterium atrosepticum | Q6RK53 | 24391954 | |
SS00679 | aopB | AopB (UniProt) | Aeromonas hydrophila | Q6TLM0 | WP_043123807.1 | 24391954 |
SS00680 | xopC | Type III effector XopC (UniProt) | Xanthomonas euvesicatoria | Q6TQF0 | CAJ24112.1 | 23437191 |
SS00681 | ALP25_03258 | Orf34 (UniProt) | Pseudomonas syringae | Q6VE93 | WP_011152901.1 | 24391954 |
SS00683 | ipaH1.4 | IpaH1.4 (UniProt, NCBI) | Shigella flexneri | Q6XVT8 | AAP79042.1 | 23437191 |
SS00684 | popP1 | PopP1 protein (UniProt, NCBI) | Ralstonia solanacearum | Q700V9 | CAF32331.1 | 24391954 |
SS00685 | popP1 | Avirulence protein AvrRxv (UniProt) | Ralstonia solanacearum | Q700W1 | WP_051048318.1 | 26120140 |
SS00686 | sipB | Cell invasion protein SipB (UniProt) | Salmonella enterica | Q79BT1 | 26120140 | |
SS00687 | hopD2 | Effector protein hopD2 (UniProt, NCBI) | Pseudomonas syringae | Q79LY0 | KPY25151.1 | 24391954 |
SS00688 | bll8201 | Bll1862 protein (UniProt) | Bradyrhizobium diazoefficiens | Q79UN8 | AND87458.1 | 24391954 |
SS00689 | sopE | Guanine nucleotide exchange factor SopE (UniProt) | Salmonella enterica | Q7BD17 | WP_000161708.1 | 26120140 |
SS00690 | avrRpm1 | avrPmaA1 (NCBI) | Pseudomonas syringae | Q7BE94 | CAA48009.1 | 19390696 |
SS00691 | ospD3 | OspD3 (SenA), probably secreted by the Mxi-Spa secretion machinery, function unknown (NCBI) | Shigella flexneri | Q7BEN0 | YP_009062471.1 | 26120140 |
SS00692 | avrE | AvrE (UniProt, NCBI) | Pseudomonas syringae | Q7BM43 | AAF71499.1 | 26120140 |
SS00693 | nopB | nodulation protein NolB (NCBI) | Rhizobium fredii | Q7BMF3 | WP_014857557.1 | 26120140 |
SS00694 | yopE | Yop effector YopE (UniProt) | Yersinia enterocolitica | Q7BRY7 | CBY78144.1 | 19390696 |
SS00695 | yopH | Yop effector YopH (UniProt) | Yersinia enterocolitica | Q7BRY8 | WP_010891234.1 | 19390696 |
SS00696 | yscH | Secreted protein YopR (UniProt) | Yersinia enterocolitica | Q7BRZ4 | Q01249.1 | 19390696 |
SS00697 | yopQ | YopQ (UniProt, NCBI) | Yersinia enterocolitica | Q7BS06 | NP_052384.1 | 19390696 |
SS00698 | virA | Cysteine protease-like VirA (UniProt) | Shigella flexneri | Q7BU69 | YP_009062518.1 | 23437191 |
SS00699 | sseB | Secreted effector protein SseB (UniProt) | Salmonella enterica | Q7BVH7 | 23437191 | |
SS00700 | sopE2 | Guanine nucleotide exchange factor sopE2 (UniProt) | Salmonella enterica | Q7CQD4 | 19390696 | |
SS00701 | espD | EspD (UniProt) | Escherichia coli | Q7DB81 | EEC7222169.1 | 9080609 |
SS00702 | espF | EspF (UniProt) | Escherichia coli | Q7DB85 | WP_000931693.1 | 19390696 |
SS00703 | plu4750 | Uncharacterized protein (UniProt) | Photorhabdus luminescens | Q7MYD1 | CAE17122.1 | 23437191 |
SS00704 | plu2515 | hypothetical protein AA106_04990 (NCBI) | Photorhabdus luminescens | Q7N439 | KTL62881.1 | 24391954 |
SS00705 | sseE | Secretion system effector SseE (UniProt) | Chromobacterium violaceum | Q7NUX3 | SUX35772.1 | 24391954 |
SS00706 | spvC | Hydrophilic protein, virA protein (UniProt) | Chromobacterium violaceum | Q7NYG6 | WP_011134862.1 | 26120140 |
SS00707 | CV_0296 | Toxin sopE2 (NCBI) | Chromobacterium violaceum | Q7P1B7 | SUX40438.1 | 24391954 |
SS00708 | Psyr_0527 | Putative type III effector HolPtoACPsy (UniProt) | Pseudomonas syringae | Q7PC42 | AAY35597.1 | 19390696 |
SS00709 | Psyr_0778 | Putative type III effector HolPsyAG (UniProt) | Pseudomonas syringae | Q7PC45 | AAY35836.2 | 19390696 |
SS00710 | hopAE1 | Effector protein hopAE1 (UniProt, NCBI) | Pseudomonas syringae | Q7PC62 | WP_011268930.1 | 19390696 |
SS00711 | bopB | Putative outer protein B (UniProt) | Bordetella pertussis | Q7VWI4 | WP_010930824.1 | 23437191 |
SS00712 | cif | type III secretion system effector Cif (NCBI) | Escherichia coli | Q7WRZ5 | EFA4278516.1 | 24391954 |
SS00713 | CCA_00170 | type III secretion system actin-recruiting effector Tarp (NCBI) | Chlamydophila caviae | Q824H6 | WP_011006142.1 | 19390696 |
SS00714 | ipaH3 | E3 ubiquitin-protein ligase ipaH3 (UniProt) | Shigella flexneri | Q83RJ4 | WP_011069360.1 | 26120140 |
SS00715 | hpaG | HpaG (UniProt) | Xanthomonas axonopodis | Q83XF9 | ABK51582.1 | 26120140 |
SS00716 | hopA1 | HopA1 (UniProt) | Pseudomonas syringae | Q83YM3 | 26120140 | |
SS00717 | hopX1 | AvrPphE (UniProt) | Pseudomonas amygdali | Q83YM6 | RMV93069.1 | 26120140 |
SS00718 | ALO72_02855 | Uncharacterized protein (UniProt) | Pseudomonas syringae | Q83YN7 | 26120140 | |
SS00719 | avrE | AvrE (UniProt) | Pseudomonas syringae | Q840G7 | AAP31245.1 | 26120140 |
SS00720 | CYO81_08295 | type III secreted protein BopD (NCBI) | Bordetella pertussis | Q84CS5 | ETH08364.1 | 26120140 |
SS00721 | bopN | BopN protein (UniProt) | Bordetella pertussis | Q84CS9 | AIW92506.1 | 23437191 |
SS00722 | yopP | type III secretion system YopJ family effector YopP (NCBI) | Yersinia enterocolitica | Q84GR3 | WP_005176633.1 | 23437191 |
SS00723 | yopM | Yop effector YopM (UniProt) | Yersinia enterocolitica | Q84GT9 | WP_011100754.1 | 11575934 |
SS00724 | VPA1370 | type III secretion system effector VopL (NCBI) | Vibrio parahaemolyticus | Q87GE5 | WP_005491021.1 | 24391954 |
SS00725 | VPA1357 | hypothetical protein D025_1473 (NCBI) | Vibrio parahaemolyticus | Q87GF9 | EQM46419.1 | 26120140 |
SS00726 | VPA1327 | T3SS effector ADP-ribosyltransferase toxin VopT (NCBI) | Vibrio parahaemolyticus | Q87GI9 | NES63684.1 | 24391954 |
SS00727 | vopS | Adenosine monophosphate-protein transferase VopS (UniProt) | Vibrio parahaemolyticus | Q87P32 | Q87P32.1 | 23437191 |
SS00728 | VP1683 | type III secretion system effector VopR (NCBI) | Vibrio parahaemolyticus | Q87P35 | WP_005464656.1 | 24391954 |
SS00729 | VP1680 | type III secretion system effector VopQ (NCBI) | Vibrio parahaemolyticus | Q87P38 | WP_005464333.1 | 23437191 |
SS00730 | PSPTO_5354 | Type III effector HopA1 (UniProt) | Pseudomonas syringae | Q87UE5 | WP_011105440.1 | 26120140 |
SS00731 | PSPTO_5061 | HopAN1 protein (UniProt) | Pseudomonas syringae | Q87V79 | AAO58488.1 | 19390696 |
SS00732 | hopI1 | Type III effector HopI1 (UniProt) | Pseudomonas syringae | Q87W07 | WP_005763320.1 | 19390696 |
SS00733 | hopG1 | Type III effector HopG1 (UniProt) | Pseudomonas syringae | Q87W42 | AAO53316.1 | 19390696 |
SS00734 | hopV1 | Type III effector HopV1 (UniProt, NCBI) | Pseudomonas syringae | Q87W46 | AAO58158.1 | 19390696 |
SS00735 | hopAA1-2 | Type III effector HopAA1-2 (UniProt) | Pseudomonas syringae | Q87W48 | AAO33453.1 | 26120140 |
SS00736 | hopAD1 | Effector protein hopAD1 (UniProt, NCBI) | Pseudomonas syringae | Q87W65 | WP_011105124.1 | 19390696 |
SS00737 | hopS1 | Type III effector HopS1 (UniProt, NCBI) | Pseudomonas syringae | Q87WF4 | AAO58043.1 | 24391954 |
SS00738 | hopO1-2 | Type III effector HopO1-2 (UniProt, NCBI) | Pseudomonas syringae | Q87WF6 | AAO58040.1 | 26120140 |
SS00739 | hopO1-2 | Type III effector HopT1-2 (UniProt, NCBI) | Pseudomonas syringae | Q87WF7 | AAO58039.1 | 19390696 |
SS00740 | hopO1-3 | Type III effector HopO1-3 (UniProt, NCBI) | Pseudomonas syringae | Q87WF8 | WP_011105071.1 | 26120140 |
SS00741 | hopS2 | Type III effector HopS2 (UniProt, NCBI) | Pseudomonas syringae | Q87WG2 | AAO58034.1 | 26120140 |
SS00742 | hopE1 | Type III effector HopE1 (UniProt) | Pseudomonas syringae | Q87X57 | AAO53317.1 | 19390696 |
SS00743 | hopAK1 | Type III helper protein HopAK1 (UniProt, NCBI) | Pseudomonas syringae | Q87XS5 | WP_011104876.1 | 19390696 |
SS00744 | hopAH2-2 | Type III effector HopAH2-2 (UniProt, NCBI) | Pseudomonas syringae | Q87ZX9 | AAO56771.1 | 26120140 |
SS00745 | hopAH2-1 | Type III effector HopAH2-1 (UniProt) | Pseudomonas syringae | Q87ZY0 | WP_011104480.1 | 26120140 |
SS00746 | PSPTO_2872 | HopL1 protein (UniProt, NCBI) | Pseudomonas syringae | Q881L7 | AAO56368.1 | 19390696 |
SS00747 | hopP1 | Type III helper protein HopP1 (UniProt, NCBI) | Pseudomonas syringae | Q882F0 | AAO56180.1 | 19390696 |
SS00748 | hopAF1 | Type III effector HopAF1 (UniProt) | Pseudomonas syringae | Q886L1 | 19390696 | |
SS00749 | hrcQa | Type III secretion protein hrcQa (UniProt, NCBI) | Pseudomonas syringae | Q887B7 | WP_011103535.1 | |
SS00750 | avrE1 | Type III effector protein AvrE1 (UniProt, NCBI) | Pseudomonas syringae | Q887C9 | AAO54899.1 | 23437191 |
SS00751 | hopM1 | Effector protein HopM1 (UniProt, NCBI) | Pseudomonas syringae | Q887D0 | WP_005763919.1 | 19390696 |
SS00752 | hopAI1 | Type III effector HopAI1 (UniProt, NCBI) | Pseudomonas syringae | Q888W0 | AAO54440.1 | 19390696 |
SS00753 | hopAG1 | Type III effector HopAG1 (UniProt, NCBI) | Pseudomonas syringae | Q888W3 | AAO54435.1 | 23437191 |
SS00754 | hopR1 | Type III effector HopR1 (UniProt, NCBI) | Pseudomonas syringae | Q888Y1 | AAO54417.1 | 19390696 |
SS00755 | hopQ1-1 | Type III effector HopQ1-1 (UniProt, NCBI) | Pseudomonas syringae | Q888Y7 | AAO54411.1 | 19390696 |
SS00756 | hopD1 | Effector protein hopD1 (UniProt, NCBI) | Pseudomonas syringae | Q888Y8 | WP_011103324.1 | 23437191 |
SS00757 | hopAJ1 | Type III helper protein HopAJ1 (UniProt, NCBI) | Pseudomonas syringae | Q889A9 | AAO54387.1 | 19390696 |
SS00758 | hopH1 | Type III effector HopH1 (UniProt, NCBI) | Pseudomonas syringae | Q88A09 | AAO54130.1 | 19390696 |
SS00759 | hopF2 | type III effector HopF2 (NCBI) | Pseudomonas syringae | Q88A90 | AAO54046.1 | 26120140 |
SS00760 | hopAS1 | Type III effector HopAS1 (UniProt, NCBI) | Pseudomonas syringae | Q88AB8 | AAO54018.1 | 19390696 |
SS00761 | hopY1 | Type III effector HopY1 (UniProt, NCBI) | Pseudomonas syringae | Q88BF6 | AAO53615.1 | 19390696 |
SS00762 | hopT1-1 | Type III effector HopT1-1 (UniProt) | Pseudomonas syringae | Q88BP7 | AAO59044.1 | 26120140 |
SS00763 | hopO1-1 | Type III effector HopO1-1 (UniProt) | Pseudomonas syringae | Q88BP8 | AAO59043.1 | 26120140 |
SS00764 | HopX1 | Type III effector HopX1 (UniProt) | Pseudomonas syringae | Q88BQ2 | 23437191 | |
SS00765 | bll8244 | Bll8244 protein (UniProt) | Bradyrhizobium diazoefficiens | Q89BB8 | AND93063.1 | 23437191 |
SS00766 | nodN | Nodulation protein N (UniProt) | Bradyrhizobium diazoefficiens | Q89N83 | AWO90898.1 | 26120140 |
SS00767 | blr1904 | Blr1904 protein (UniProt) | Bradyrhizobium diazoefficiens | Q89TL5 | AND87489.1 | 23437191 |
SS00768 | nolB | type III effector NopB (NCBI) | Bradyrhizobium diazoefficiens | Q89TP9 | AGH09934.1 | 26120140 |
SS00769 | blr1693 | Blr1693 protein (UniProt) | Bradyrhizobium diazoefficiens | Q89TT5 | AND87313.1 | 24391954 |
SS00770 | blr1656 | Blr1656 protein (UniProt) | Bradyrhizobium diazoefficiens | Q89TW7 | AGH09984.1 | 23437191 |
SS00771 | blr1649 | Blr1649 protein (UniProt) | Bradyrhizobium diazoefficiens | Q89TX4 | WP_011084464.1 | 24391954 |
SS00772 | xopD | Xanthomonas outer protein D (NCBI) | Xanthomonas euvesicatoria | Q8RJQ0 | CAJ22068.1 | 23437191 |
SS00773 | avrPphDPgy | Effector protein AvrPphDPgy (UniProt, NCBI) | Pseudomonas savastanoi | Q8RK06 | Q8RK06.1 | 21106126 |
SS00774 | avrPphDPsv | Effector protein AvrPphDPsv (UniProt, NCBI) | Pseudomonas savastanoi | Q8RK07 | PAB34947.1 | 21106126 |
SS00775 | hopAB1 | Effector protein hopAB1 (UniProt) | Pseudomonas savastanoi | Q8RK09 | CAD29302.1 | 21106126 |
SS00776 | hopAB1 | Effector protein hopAB1 (UniProt) | Pseudomonas savastanoi | Q8RK12 | Q8RK12.1 | 21106126 |
SS00777 | Type III effector AvrEPma (UniProt) | Pseudomonas syringae | Q8RNY8 | AAL84254.1 | 26120140 | |
SS00778 | Type III effector HopPtoA1Pma (UniProt, NCBI) | Pseudomonas syringae | Q8RP03 | AAL84253.1 | 19390696 | |
SS00779 | hopAB3 | Effector protein hopAB3 (UniProt) | Pseudomonas syringae | Q8RP04 | AAL84252.1 | 26120140 |
SS00780 | Type III effector HopI1 (UniProt) | Pseudomonas syringae | Q8RP09 | 26120140 | ||
SS00781 | hopZ1 | HopZ1 (UniProt) | Pseudomonas syringae | Q8RP13 | AAL84243.1 | 26120140 |
SS00782 | hopW1-1 | Effector protein hopW1-1 (UniProt) | Pseudomonas syringae | Q8RP17 | YP_025680.1 | 26120140 |
SS00783 | hopAB2 | Effector protein HopAB2 (UniProt) | Pseudomonas syringae | Q8RSY1 | AAL71883.1 | 26120140 |
SS00784 | ropE | Putative type III secreted protein (UniProt, NCBI) | Pseudomonas fluorescens | Q8VPK4 | AAK74145.1 | 24391954 |
SS00785 | sopE | Guanine nucleotide exchange factor SopE (UniProt) | Salmonella enterica | Q8VPM1 | WP_000161703.1 | 26120140 |
SS00786 | sipA | Cell invasion protein SipA (UniProt) | Salmonella enterica | Q8VQB5 | WP_000258819.1 | 26120140 |
SS00787 | ipaH9.8 | E3 ubiquitin-protein ligase ipaH9.8 (UniProt) | Shigella flexneri | Q8VSC3 | WP_011114775.1 | |
SS00788 | ospF | Phosphothreonine lyase OspF (UniProt) | Shigella flexneri | Q8VSP9 | 26120140 | |
SS00789 | sopE | Guanine nucleotide exchange factor SopE (UniProt) | Salmonella enterica | Q8VSQ6 | WP_000161702.1 | 26120140 |
SS00790 | sopE | Guanine nucleotide exchange factor SopE (UniProt) | Salmonella enterica | Q8VSR1 | WP_023187541.1 | 26120140 |
SS00791 | sopE | Guanine nucleotide exchange factor SopE (UniProt) | Salmonella enterica | Q8VSR2 | WP_002953107.1 | 26120140 |
SS00792 | espF(U) | Secreted effector protein EspF(U) (UniProt, NCBI) | Escherichia coli | Q8X482 | Q8X482.1 | |
SS00793 | nleG2-2 | T3SS secreted effector NleG (NCBI) | Escherichia coli | Q8X4X1 | NP_310021.1 | 24391954 |
SS00794 | espK | GogB (Reference); T3SS secreted effector EspK (UniProt, NCBI) | Escherichia coli | Q8X782 | WP_000938118.1 | 16990433;24391954 |
SS00795 | nleF | Effector protein NleF (UniProt) | Escherichia coli | Q8XAL7 | WP_000938103.1 | |
SS00796 | st47 | ST47 protein (UniProt) | Escherichia coli | Q8XBX7 | EEC7188973.1 | 19390696 |
SS00797 | espB | EaeB (UniProt) | Escherichia coli | Q8XC86 | WP_001092000.1 | 19390696 |
SS00798 | RSp1281 | Putative type III effector protein (UniProt) | Ralstonia solanacearum | Q8XQE6 | AST30242.1 | 26120140 |
SS00799 | ripA | Type III effector protein awr1 (UniProt, NCBI) | Ralstonia solanacearum | Q8XTK9 | CAD17250.1 | 26120140 |
SS00800 | brg11 | TAL effector protein Brg11 (UniProt) | Ralstonia solanacearum | Q8XYE3 | ||
SS00801 | popP2 | Type III effector protein popp2 (UniProt) | Ralstonia solanacearum | Q8Y125 | WP_043876564.1 | 24391954 |
SS00802 | pipB2 | Secreted effector protein PipB2 (UniProt) | Salmonella enterica | Q8Z4G9 | WP_001801692.1 | 26120140 |
SS00803 | sseL | Deubiquitinase SseL (UniProt) | Salmonella enterica | Q8Z550 | WP_001017745.1 | 26120140 |
SS00804 | sseC | SPI-2 type III secretion system translocon protein SseC (NCBI) | Salmonella enterica | Q8Z6L6 | WP_001079758.1 | 24391954 |
SS00805 | sopB | Inositol phosphate phosphatase SopB (UniProt) | Salmonella enterica | Q8Z7R1 | WP_001166955.1 | 21106126 |
SS00806 | avrA | type III secretion system YopJ family effector AvrA (NCBI) | Salmonella enterica | Q8ZMI3 | EBV3011379.1 | 26120140 |
SS00807 | pipB2 | Secreted effector protein PipB2 (UniProt) | Salmonella enterica | Q8ZMM8 | AYG15287.1 | 26120140 |
SS00808 | STM2614 | Gifsy-1 prophage protein (UniProt) | Salmonella enterica | Q8ZMY7 | 26120140 | |
SS00809 | gogB | Gifsy-1 prophage leucine-rich repeat protein (UniProt) | Salmonella enterica | Q8ZN18 | WP_010989047.1 | 24391954 |
SS00810 | sseL | Deubiquitinase SseL (UniProt) | Salmonella enterica | Q8ZNG2 | AZR55017.1 | 26120140 |
SS00811 | STM2137 | type III secretion system effector arginine glycosyltransferase SseK2 (NCBI) | Salmonella enterica | Q8ZNP4 | WP_010989041.1 | 26120140 |
SS00812 | sopA | E3 ubiquitin-protein ligase SopA (UniProt) | Salmonella enterica | Q8ZNR3 | WP_000703998.1 | 19390696 |
SS00813 | steC | Secreted effector kinase SteC (UniProt) | Salmonella enterica | Q8ZP57 | AZR50674.1 | 26120140 |
SS00814 | steB | Secreted effector protein SteB (UniProt, NCBI) | Salmonella enterica | Q8ZPA6 | AQY77888.1 | 21106126 |
SS00815 | steA | Secreted effector protein SteA (UniProt, NCBI) | Salmonella enterica | Q8ZPD7 | AMZ52892.1 | 26120140 |
SS00816 | pipB | Secreted effector protein PipB (UniProt) | Salmonella enterica | Q8ZQ59 | AZR51290.1 | 26120140 |
SS00817 | sseI | Secreted effector protein SseI (UniProt) | Salmonella enterica | Q8ZQ79 | AZR56356.1 | 26120140 |
SS00818 | STM1026 | Gifsy-2 prophage protein (UniProt) | Salmonella enterica | Q8ZQA1 | EDB9851882.1 | 26120140 |
SS00819 | sopD2 | Secreted effector protein sopD2 (UniProt) | Salmonella enterica | Q8ZQC8 | AZR51399.1 | 26120140 |
SS00820 | slrP | SlrP (Reference); E3 ubiquitin-protein ligase SlrP (UniProt) | Salmonella enterica | Q8ZQQ2 | 19690162;23437191 | |
SS00821 | yopP | Yop effector YopP (UniProt) | Yersinia enterocolitica | Q93KQ5 | 19390696 | |
SS00822 | yopO | Protein kinase YopO (UniProt) | Yersinia enterocolitica | Q93KQ6 | WP_011100759.1 | 17121817 |
SS00823 | yopM | Yop effector YopM (UniProt) | Yersinia enterocolitica | Q93KU8 | AJJ21446.1 | 19390696 |
SS00824 | aexT | ADP-ribosyltransferase toxin AexT (UniProt, NCBI) | Aeromonas salmonicida | Q93Q17 | Q93Q17.1 | 23437191 |
SS00825 | yopT | Cysteine protease YopT (UniProt, NCBI) | Pseudomonas fluorescens | Q93RN4 | Q93RN4.2 | 19390696 |
SS00826 | aroK | Shikimate kinase (UniProt) | Rhizobium loti | Q989M4 | 23437191 | |
SS00827 | mlr8763 | Mlr8763 protein (UniProt) | Rhizobium loti | Q989P6 | 26120140 | |
SS00828 | mll6337 | Nodulation protein NolX (UniProt) | Rhizobium loti | Q989P8 | 26120140 | |
SS00829 | mlr6316 | Mlr6316 protein (UniProt) | Rhizobium loti | Q989R4 | 24391954 | |
SS00830 | ospG | Protein kinase OspG (UniProt) | Shigella flexneri | Q99PZ6 | YP_009062537.1 | 23437191 |
SS00831 | sopB | Inositol phosphate phosphatase SopB (UniProt) | Salmonella bongori | Q9AH17 | AAK27357.1 | 26120140 |
SS00832 | sopB | Inositol phosphate phosphatase SopB (UniProt) | Salmonella enterica | Q9AH18 | AAK27356.1 | 26120140 |
SS00833 | sopB | Inositol phosphate phosphatase SopB (UniProt) | Salmonella enterica | Q9AH19 | AAK27355.1 | 26120140 |
SS00834 | ipgB2 | IpgB2 (UniProt) | Shigella flexneri | Q9AJW7 | YP_009062459.1 | 23437191 |
SS00835 | blr2058 | Putative cysteine protease YopT-like blr2058 (UniProt, NCBI) | Bradyrhizobium diazoefficiens | Q9AMW4 | Q9AMW4.1 | 23437191 |
SS00836 | id636 | ID636 (UniProt) | Bradyrhizobium japonicum | Q9AN16 | AGH09962.1 | 24391954 |
SS00837 | hrpA | Hrp pili protein HrpA (UniProt) | Pseudomonas savastanoi | Q9F0B1 | AAZ35032.1 | |
SS00838 | hrcQb | Type III secretion protein HrcQb (UniProt, NCBI) | Pseudomonas syringae | Q9F0H3 | WP_005763877.1 | |
SS00839 | avrPpiC2 | Probable cysteine protease avirulence protein AvrPpiC2 (UniProt, NCBI) | Pseudomonas syringae | Q9F3T4 | Q9F3T4.1 | 19390696 |
SS00840 | avrppiG1 | AvrPpiG1 protein (UniProt) | Pseudomonas syringae | Q9F3T5 | WP_003349456.1 | 24391954 |
SS00841 | avrPphD | Effector protein AvrPphD (UniProt) | Pseudomonas savastanoi | Q9F3T6 | WP_011282444.1 | 26120140 |
SS00842 | wtsE | WtsE (UniProt, NCBI) | Pantoea stewartii | Q9FCY7 | AAG01467.2 | 23437191 |
SS00843 | sseJ | Secreted effector protein SseJ (UniProt) | Salmonella enterica | Q9FD10 | AKW02614.2 | 26120140 |
SS00844 | exoT | Exoenzyme T (UniProt) | Pseudomonas aeruginosa | Q9I788 | WP_003114583.1 | 19680249 |
SS00845 | ALO36_02903 | Type III effector HopN1 (UniProt, NCBI) | Pseudomonas syringae | Q9JP32 | AAO54892.1 | 19390696 |
SS00846 | ORF2 (UniProt, NCBI) | Pseudomonas savastanoi | Q9K2L5 | AAF67149.1 | 19390696 | |
SS00847 | sifB | Secreted effector protein SifB (UniProt) | Salmonella enterica | Q9KIB9 | AJQ69616.1 | 26120140 |
SS00848 | tir | Tir (UniProt, NCBI) | Escherichia coli | Q9KWH9 | BAA96815.1 | 23437191 |
SS00849 | hrpK | type III helper protein HrpK1 (NCBI) | Pseudomonas syringae | Q9L6W3 | WP_011103539.1 | 19390696 |
SS00850 | ALO36_02932 | Type III effector HopB1 (UniProt, NCBI) | Pseudomonas syringae | Q9L6W4 | AAO54928.1 | 19390696 |
SS00851 | STMF1.17 | type III secretion system effector arginine glycosyltransferase SseK1 (NCBI) | Salmonella enterica | Q9L9J3 | ECM2300820.1 | 26120140 |
SS00852 | sseD | Secreted effector protein SseD (UniProt) | Salmonella enterica | Q9R803 | ATQ02846.1 | 23437191 |
SS00853 | popA | Protein PopA1 (UniProt) | Ralstonia solanacearum | Q9RBS0 | WP_011004174.1 | 24391954 |
SS00854 | popB | Protein PopB (UniProt, NCBI) | Ralstonia solanacearum | Q9RBS1 | AKZ28783.1 | 24391954 |
SS00855 | popC | Protein PopC (UniProt, NCBI) | Ralstonia solanacearum | Q9RBS2 | Q9RBS2.2 | 24391954 |
SS00856 | hopAB1 | Effector protein hopAB1 (UniProt, NCBI) | Pseudomonas savastanoi | Q9RBW3 | AAZ37972.1 | 24391954 |
SS00857 | sopB | Inositol phosphate phosphatase SopB (UniProt) | Salmonella blockley | Q9RER2 | 21106126 | |
SS00858 | bopB | Outer protein B (UniProt, NCBI) | Bordetella bronchiseptica | Q9REZ5 | AAF15898.1 | 24391954 |
SS00859 | bsp22 | Secreted protein 22 (UniProt) | Bordetella bronchiseptica | Q9REZ7 | WP_003809882.1 | 23437191 |
SS00860 | ypkA | Protein kinase YpkA (UniProt) | Yersinia pestis | Q9RI12 | WP_002213290.1 | 26120140 |
SS00861 | sopE | Guanine nucleotide exchange factor SopE (UniProt) | Salmonella enterica | Q9RPM6 | WP_000161708.1 | 26120140 |
SS00862 | incD | inclusion membrane protein IncD (NCBI) | Chlamydia trachomatis | B7SCE0 | WP_009873570.1 | 24391954 |
SS00863 | sopA | E3 ubiquitin-protein ligase SopA (UniProt) | Salmonella enterica | Q9S4P4 | Q9S4P4.1 | |
SS00864 | avrBs2 | Avirulence protein AvrBs2 (UniProt, NCBI) | Xanthomonas euvesicatoria | Q9Z3F4 | CAJ21683.1 | 23437191 |
SS00865 | lcrH_2 | Low Calcium Response Protein H (UniProt, NCBI) | Chlamydia pneumoniae | Q9Z6N8 | AAD19158.1 | 24391954 |
SS00866 | yscL | Translocation protein L (UniProt) | Chlamydia pneumoniae | Q9Z780 | WP_010883463.1 | 24391954 |
SS00867 | CPn0821 homolog | Uncharacterized protein CPn0821 homolog (UniProt) | Chlamydia pneumoniae | Q9Z785 | AAD18959.1 | 24391954 |
SS00868 | CP_1108 | CT648 hypothetical protein (NCBI) | Chlamydia pneumoniae | Q9Z7E2 | AAD18902.1 | 24391954 |
SS00869 | yscN | Probable ATP synthase YscN (UniProt) | Chlamydia pneumoniae | Q9Z7J8 | WP_010883345.1 | 24391954 |
SS00870 | yscC | Outer membrane secretion protein Q (UniProt) | Chlamydia pneumoniae | Q9Z7K3 | WP_010883340.1 | 24391954 |
SS00871 | CP_0099 | CT529 hypothetical protein (NCBI) | Chlamydia pneumoniae | Q9Z7Q6 | AAD18787.1 | 24391954 |
SS00872 | CP_0163 | CPj0585 protein (UniProt) | Chlamydia pneumoniae | Q9Z7W9 | BAA98792.1 | 19390696 |
SS00873 | CPn_0572 | type III secretion system actin-recruiting effector Tarp (NCBI) | Chlamydia pneumoniae | Q9Z7Y1 | WP_010883210.1 | 19390696 |
SS00874 | CP_0264 | CT387 hypothetical protein (NCBI) | Chlamydia pneumoniae | Q9Z861 | AAD18630.1 | 24391954 |
SS00875 | CP_0280 | CT365 hypothetical protein (NCBI) | Chlamydia pneumoniae | Q9Z877 | AAD18614.1 | 24391954 |
SS00876 | CP_0382 | peptidoglycan editing factor PgeF (NCBI) | Chlamydia pneumoniae | Q9Z8G9 | WP_010883017.1 | 24391954 |
SS00877 | sycE | Scc1 (UniProt, NCBI) | Chlamydia pneumoniae | Q9Z8L3 | AAP98268.1 | 24391954 |
SS00878 | lcrE | Low Calcium Response E (UniProt) | Chlamydia pneumoniae | Q9Z8L4 | WP_010882972.1 | 19390696 |
SS00879 | CP_0450 | CPj0308 protein (UniProt) | Chlamydia pneumoniae | Q9Z8N0 | BAA98518.1 | 23437191 |
SS00880 | incC | inclusion membrane protein IncC (NCBI) | Chlamydia pneumoniae | Q9Z8P6 | WP_010882940.1 | 19390696 |
SS00881 | incB | inclusion membrane protein IncB (NCBI) | Chlamydia pneumoniae | Q9Z8P7 | WP_010882939.1 | 19390696 |
SS00882 | CPn_0206, CP_0561, CPj0206, CpB0210 | Uncharacterized protein CPn_0206/CP_0561/CPj0206/CpB0210 (UniProt) | Chlamydia pneumoniae | Q9Z8X8 | AAD18359.1 | 24391954 |
SS00883 | CP_0581 | CPj0186 protein (UniProt) | Chlamydia pneumoniae | Q9Z8Z8 | WP_010882837.1 | 19390696 |
SS00884 | xopQ | Type III effector protein (UniProt) | Xanthomonas oryzae | R4TJS0 | AGM16438.1 | 26120140 |
SS00885 | hopI1 | Type III secretion system effector HopI1 (UniProt, NCBI) | Pseudomonas syringae | S3MPF6 | EPF68418.1 | 26120140 |
SS00886 | hopBA1 | Type III secretion system effector HopBA1 (UniProt, NCBI) | Pseudomonas syringae | S3MY93 | AKF51360.1 | 26120140 |
SS00887 | hopAA1 | Type III secretion system effector HopAA1 (UniProt, NCBI) | Pseudomonas syringae | S3NG26 | EPF65306.1 | 26120140 |
SS00888 | avrE1 | Type III secretion system effector AvrE1 (UniPrott, NCBI) | Pseudomonas syringae | S3NG30 | EPF65311.1 | 26120140 |
SS00890 | Molecular chaperone DnaJ (UniProt) | Molecular chaperone DnaJ (UniProt) | Pseudomonas syringae | A0A0W0PVZ9 | EPM52592.1 | 26120140 |
SS00891 | A244_36138 | Type III effector HopX1 (UniProt, NCBI) | Pseudomonas syringae | S6SR13 | EPM70483.1 | 26120140 |
SS00892 | A244_35923 | Type III effector protein AvrE1 (UniProt) | Pseudomonas syringae | S6SWN6 | EPN33782.1 | 26120140 |
SS00893 | A244_35888 | Type III effector HopAA1-1 (UniProt) | Pseudomonas syringae | S6SWQ6 | EPN33802.1 | 26120140 |
SS00894 | ALQ07_00754 | Type III effector HopY1 (UniProt, NCBI) | Pseudomonas syringae | A0A3M4L3G7 | EPM51152.1 | 26120140 |
SS00895 | A244_32551 | Type III effector HopAB2 (UniProt) | Pseudomonas syringae | S6T863 | EPN37959.1 | 26120140 |
SS00896 | A245_35725 | Type III effector HopA1 (UniProt) | Pseudomonas syringae | A0A656JP60 | EPN41951.1 | 26120140 |
SS00897 | A244_22116 | Type III effector HopAG1 (UniProt, NCBI) | Pseudomonas syringae | S6TTJ9 | EPN46956.1 | 26120140 |
SS00898 | A244_36148 | Type III effector HopF2 (UniProt, NCBI) | Pseudomonas syringae | S6TW99 | EPN33709.1 | 26120140 |
SS00899 | A244_35918 | Type III effector protein AvrE1 (UniProt) | Pseudomonas syringae | S6TWG5 | EPN33786.1 | 26120140 |
SS00900 | A244_35883 | Type III effector HopAA1-1 (UniProt) | Pseudomonas syringae | S6TWP0 | EPN33861.1 | 26120140 |
SS00901 | A245_42480 | Type III effector HopS2 (UniProt, NCBI) | Pseudomonas syringae | A0A656JKR5 | EPM52286.1 | 26120140 |
SS00902 | ALQ07_00790 | Type III effector HopT1-2 (UniProt, NCBI) | Pseudomonas syringae | A0A3M4KMZ4 | EPM52288.1 | 26120140 |
SS00903 | A244_37574 | Type III effector HopF2 (UniProt, NCBI) | Pseudomonas syringae | S6U3U1 | EPM43426.1 | 26120140 |
SS00904 | A244_17751 | Type III effector HopAH2-2 (UniProt, NCBI) | Pseudomonas syringae | S6U6V3 | EPN51680.1 | 26120140 |
SS00905 | A245_42465 | Type III effector HopO1-2 (UniProt, NCBI) | Pseudomonas syringae | A0A656JKS4 | EPM52289.1 | 26120140 |
SS00906 | A245_39011 | Type III effector HopA1 (UniProt) | Pseudomonas syringae | A0A656JMC6 | EPN38168.1 | 26120140 |
SS00907 | A245_23134 | Type III effector HopAH2-1 (UniProt) | Pseudomonas syringae | A0A656JUW2 | EPN55544.1 | 26120140 |
SS00908 | A244_01615 | Type III effector HopO1-2 (UniProt, NCBI) | Pseudomonas syringae | S6V7U9 | EPM52289.1 | 26120140 |
SS00909 | A244_00040 | Type III effector HopI1 (UniProt) | Pseudomonas syringae | S6VA78 | EPN64641.1 | 26120140 |
SS00910 | A244_00045 | Type III effector HopI1 (UniProt) | Pseudomonas syringae | S6VCW1 | EPN64627.1 | 26120140 |
SS00911 | A245_06015 | Type III effector HopAB2 (UniProt) | Pseudomonas syringae | A0A656K2Q9 | EPN66541.1 | 26120140 |
SS00912 | A244_17756 | Type III effector HopAH2-1 (UniProt, NCBI) | Pseudomonas syringae | S6VK55 | EPN51681.1 | 26120140 |
SS00913 | A245_23149 | Type III effector HopAH2-2 (UniProt, NCBI) | Pseudomonas syringae | A0A656JUY3 | EPN55533.1 | 26120140 |
SS00914 | A245_01978 | Type III effector protein AvrE1 (UniProt) | Pseudomonas syringae | A0A656K6U3 | EPN69327.1 | 26120140 |
SS00915 | A245_23144 | Type III effector HopAH2-1 (UniProt) | Pseudomonas syringae | A0A656JUP1 | EPN55532.1 | 26120140 |
SS00916 | A245_23139 | Type III effector HopAH2-1 (UniProt) | Pseudomonas syringae | A0A656JUZ9 | EPN55537.1 | 26120140 |
SS00917 | A245_18045 | Type III effector HopAG1 (UniProt, NCBI) | Pseudomonas syringae | A0A656JXQ0 | EPN59302.1 | 26120140 |
SS00918 | A244_07171 | Type III effector HopA1 (UniProt, NCBI) | Pseudomonas syringae | S6W322 | WP_017709273.1 | 26120140 |
SS00919 | A245_18040 | Type III effector HopAG1 (UniProt, NCBI) | Pseudomonas syringae | A0A656JXF7 | EPN59301.1 | 26120140 |
SS00920 | A244_01605 | Type III effector HopS2 (UniProt, NCBI) | Pseudomonas syringae | S6WC57 | EPM52286.1 | 26120140 |
SS00921 | A244_05049 | Type III effector HopY1 (UniProt, NCBI) | Pseudomonas syringae | S6WD38 | EPN61762.1 | 26120140 |
SS00922 | A245_02043 | Type III effector HopAA1-1 (UniProt) | Pseudomonas syringae | A0A656K4D4 | EPN69270.1 | 26120140 |
SS00923 | A245_00015 | Type III effector HopF2 (UniProt, NCBI) | Pseudomonas syringae | A0A656K8M8 | EPN06973.1 | 26120140 |
SS00924 | A245_02028 | Type III effector HopAA1-1 (UniProt) | Pseudomonas syringae | A0A656K4E5 | EPN69294.1 | 26120140 |
SS00925 | A245_01993 | Type III effector protein AvrE1 (UniProt) | Pseudomonas syringae | A0A656K491 | 26120140 | |
SS00926 | A245_01751 | Type III effector HopX1 (UniProt) | Pseudomonas syringae | A0A656K4J3 | 26120140 | |
SS00927 | AC612_21945 | Xanthomonas outer protein Q, type III effector XopQ (NCBI) | Xanthomonas citri | A0A3T0F2M8 | 26120140 | |
SS00928 | espD | EspD protein (NCBI) | Escherichia coli | CAA73507.1 | 25645555 | |
SS00929 | sseC | SseC (NCBI) | Salmonella enterica | AAC28881.1 | 21106126 | |
SS00930 | sseB | SseB (NCBI) | Salmonella enterica | CAA12185.1 | 21106126 | |
SS00931 | sseC | SseC (NCBI) | Salmonella enterica | CAA12187.1 | 21106126 | |
SS00932 | sseD | SseD (NCBI) | Salmonella enterica | CAA12188.1 | 21106126 | |
SS00933 | sseE | SseE (NCBI) | Salmonella enterica | CAA12189.1 | 21106126 | |
SS00934 | sseF | SseF (NCBI) | Salmonella enterica | CAA12191.1 | 21106126 | |
SS00935 | sseG | SseG (NCBI) | Salmonella enterica | CAA12192.1 | 21106126 | |
SS00936 | yopM | Yop targeted effector protein (plasmid) (NCBI) | Yersinia pestis | AAC69806.1 | 21106126 | |
SS00937 | yopM | Yop effector YopM (plasmid) (NCBI) | Yersinia enterocolitica | AAD16811.1 | 21106126 | |
SS00938 | yopM | Yop effector YopM (plasmid) (NCBI) | Yersinia enterocolitica | NP_052388.1 | 21106126 | |
SS00939 | Chain S, PROTEIN TYROSINE PHOSPHATASE SPTP (NCBI) | Yersinia enterocolitica | 1G4U_S | 21106126 | ||
SS00940 | Chain R, PROTEIN TYROSINE PHOSPHATASE SPTP (NCBI) | Yersinia enterocolitica | 1G4W_R | 21106126 | ||
SS00941 | Chain A, Crystal Structure Of The N-Terminal Domain Of The Tyrosine Phosphatase Yoph From Yersinia Pestis. (NCBI) | Yersinia enterocolitica | 1HUF_A | 21106126 | ||
SS00942 | yopM | Yop effector YopM (plasmid) (plasmid) (NCBI) | Yersinia enterocolitica | AAK69208.1 | 21106126 | |
SS00943 | sseE | secretion system effector (NCBI) | Salmonella enterica | AAL20326.1 | 21106126 | |
SS00944 | Chain E, Structure Of The Salmonella Virulence Effector Sptp In Complex With Its Secretion Chaperone Sicp (NCBI) | Salmonella enterica | 1JYO_E | 21106126 | ||
SS00945 | Chain A, OUTER PROTEIN YOPM (NCBI) | Salmonella enterica | 1G9U_A | 21106126 | ||
SS00946 | Chain A, Outer Protein Yopm (NCBI) | Salmonella enterica | 1JL5_A | 21106126 | ||
SS00947 | Chain A, Crystal Structure Of The Catalytic Domain Of Yope-Yersinia Pestis Gap Effector Protein. (NCBI) | Salmonella enterica | 1HY5_A | 21106126 | ||
SS00948 | Chain I, Crystal Structure Of The Yersinia Virulence Effector Yope Chaperone-Binding Domain In Complex With Its Secretion Chaperone, Syce (NCBI) | Salmonella enterica | 1L2W_I | 21106126 | ||
SS00949 | AChain A, Nmr Structure Of The Type Iii Secretory Domain Of Yersinia Yoph Complexed With The Skap-Hom Phospho-Peptide N-Acetyl- Depyddpf-Nh2 (NCBI) | Salmonella enterica | 1M0V_A | 21106126 | ||
SS00950 | yopM | Yop effector YopM (plasmid) (NCBI) | Yersinia enterocolitica | AAN37523.1 | 21106126 | |
SS00951 | sspH2 | secreted effector protein (NCBI) | Salmonella enterica | AG0786 | 21106126 | |
SS00952 | yopM | Yop effector YopM (plasmid) (NCBI) | Yersinia enterocolitica | NP_783660.1 | 21106126 | |
SS00953 | vopS | T3SS effector adenosine monophosphate-protein transferase VopS (NCBI) | Vibrio parahaemolyticus | WP_005464511 | 21106126 | |
SS00954 | secreted effector protein (NCBI) | Salmonella enterica | AAO68326.1 | 21106126 | ||
SS00955 | avrE | AvrE, partial (NCBI) | Pseudomonas syringae | AAP31245.1 | 21106126 | |
SS00956 | hpaG | HpaG (NCBI) | Xanthomonas axonopodis | AAP34334.1 | 21106126 | |
SS00957 | yopM | outer membrane protein YopM (plasmid) (NCBI) | Yersinia pestis | NP_857756.1 | 21106126 | |
SS00958 | yopM | Yop targeted effector protein (plasmid) (NCBI) | Yersinia pestis | NP_857953.1 | 21106126 | |
SS00959 | yopM | Yop effector YopM (plasmid) (NCBI) | Yersinia enterocolitica | NP_863509.1 | 21106126 | |
SS00960 | sseE | secretion system effector SseE (NCBI) | Chromobacterium violaceum | AAQ60244.1 | 21106126 | |
SS00961 | espI | type III secretion system effector (NCBI) | Citrobacter rodentium | AAQ75736.1 | 15039354 | |
SS00962 | aopB | AopB (NCBI) | Aeromonas hydrophila | AAR26341.1 | 21106126 | |
SS00963 | nleA | non-LEE encoded effector A (NCBI) | Citrobacter rodentium | AAR84051.1 | 21106126 | |
SS00964 | dspE | DspE (NCBI) | Pectobacterium atrosepticum | AAS20351.1 | 21106126 | |
SS00965 | nleC | non-LEE encoded type III effector C (NCBI) | Citrobacter rodentium | AAS47019.1 | 21106126 | |
SS00966 | nleD | non-LEE encoded type III effector D (NCBI) | Citrobacter rodentium | AAS47020.1 | 21106126 | |
SS00967 | nleF | non-LEE-encoded type III effector F (NCBI) | Citrobacter rodentium | AAS48168.1 | 21106126 | |
SS00968 | nleH | non-LEE-encoded type III effector H (NCBI) | Citrobacter rodentium | AAS48169.1 | 21106126 | |
SS00969 | yopM | putative targeted effector protein YopM (plasmid) (NCBI) | Yersinia pestis | AAS58577.1 | 21106126 | |
SS00970 | yspB | YspB (NCBI) | Sodalis glossinidius | AAS66851.1 | 21106126 | |
SS00971 | yspA | YspA (NCBI) | Sodalis glossinidius | AAS66853.1 | 21106126 | |
SS00972 | aopB | AopB (NCBI) | Aeromonas hydrophila | AAS91821.1 | 21106126 | |
SS00973 | type III secreted effector hopPmaA (plasmid) (NCBI) | Pseudomonas syringae | AAT35179.1 | 21106126 | ||
SS00974 | type III secreted effector hopPmaA (plasmid) (NCBI) | Pseudomonas syringae | YP_025680.1 | 21106126 | ||
SS00975 | nleE | NleE (NCBI) | Citrobacter rodentium | AAU95471.1 | 21106126 | |
SS00976 | aopB | AopB (NCBI) | Aeromonas hydrophila | AAV30235.1 | 21106126 | |
SS00977 | eseC | EseC (NCBI) | Edwardsiella tarda | AAV69404.1 | 21106126 | |
SS00978 | eseD | EseD (NCBI) | Edwardsiella tarda | AAV69405.1 | 21106126 | |
SS00979 | AChain A, Solution Structure Of The Folded Core Of Pseudomonas Syringae Effector Protein, Avrpto (NCBI) | Edwardsiella tarda | 1R5E_A | 21106126 | ||
SS00980 | sseF | SseF, partial (NCBI) | Salmonella enterica | AAX49626.1 | 21106126 | |
SS00981 | sseE | Secretion system effector SseE (NCBI) | Salmonella enterica | AAX65329.1 | 21106126 | |
SS00982 | eseB | EseB (NCBI) | Edwardsiella tarda | AAX76903.1 | 21106126 | |
SS00983 | eseD | type III secretion system effector protein D, partial (NCBI) | Edwardsiella tarda | BAE19884.1 | 21106126 | |
SS00984 | eseC | type III secretion system effector protein C, partial (NCBI) | Edwardsiella tarda | BAE19885.1 | 21106126 | |
SS00985 | tir | translocated intimin receptor (NCBI) | Escherichia coli | ABB16332.1 | 21106126 | |
SS00986 | tccP | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | ABB16333.1 | 21106126 | |
SS00987 | wtsE | WtsE (NCBI) | Pantoea stewartii | AAG01467.2 | 21106126 | |
SS00988 | aexT | AexT (NCBI) | Aeromonas salmonicida | ABD48949.1 | 21106126 | |
SS00989 | aopH | AopH (NCBI) | Aeromonas salmonicida | ABD48950.1 | 21106126 | |
SS00990 | aopO | AopO (NCBI) | Aeromonas salmonicida | ABD48951.1 | 21106126 | |
SS00991 | exoU | type three secretion system effector protein (NCBI) | Pseudomonas aeruginosa | ABD94685.1 | 21106126 | |
SS00992 | type three secretion effector protein (NCBI) | Pseudomonas aeruginosa | ABD94731.1 | 21106126 | ||
SS00993 | popC | PopC (NCBI) | Xanthomonas oryzae | ABG23671.1 | 21106126 | |
SS00994 | aexT | AexT (NCBI) | Aeromonas veronii | ABJ98887.1 | 21106126 | |
SS00995 | AexU (NCBI) | Aeromonas veronii | ABJ98888.1 | 21106126 | ||
SS00996 | Chain A, Bipd Of Burkholderia Pseudomallei (NCBI) | Aeromonas veronii | 2IXR_A | 21106126 | ||
SS00997 | Chain A, A Proteolytically Truncated Form Of Shigella Flexneri Ipad (NCBI) | Aeromonas veronii | 2J0N_A | 21106126 | ||
SS00998 | Chain A, Semet Substituted Shigella Flexneri Ipad (NCBI) | Aeromonas veronii | 2JAA_A | 21106126 | ||
SS00999 | nleA1 | NleA1 protein (NCBI) | Escherichia coli | CAM11313.1 | 21106126 | |
SS01000 | nleA2 | NleA2 protein (NCBI) | Escherichia coli | CAM11314.1 | 21106126 | |
SS01001 | nleA3 | NleA3 protein (NCBI) | Escherichia coli | CAM11315.1 | 21106126 | |
SS01002 | nleA4 | NleA4 protein (NCBI) | Escherichia coli | CAM11316.1 | 21106126 | |
SS01003 | nleA5 | NleA5 protein (NCBI) | Escherichia coli | CAM11317.1 | 21106126 | |
SS01004 | nleA6-1 | NleA6-1 protein (NCBI) | Escherichia coli | CAM11318.1 | 21106126 | |
SS01005 | nleA6-2 | NleA6-2 protein (NCBI) | Escherichia coli | CAM11319.1 | 21106126 | |
SS01006 | nleA7 | NleA7 protein (NCBI) | Escherichia coli | CAM11320.1 | 21106126 | |
SS01007 | nleA8-1 | NleA8-1 protein (NCBI) | Escherichia coli | CAM11321.1 | 21106126 | |
SS01008 | nleA8-2 | NleA8-2 protein (NCBI) | Escherichia coli | CAM11322.1 | 21106126 | |
SS01009 | nleA9 | NleA9 protein (NCBI) | Escherichia coli | CAM11323.1 | 21106126 | |
SS01010 | nleA10 | NleA10 protein (NCBI) | Escherichia coli | CAM11324.1 | 21106126 | |
SS01011 | nleA11 | NleA11 protein (NCBI) | Escherichia coli | CAM11325.1 | 21106126 | |
SS01012 | yopT | plasmid type III secretion system effector protein (plasmid) (NCBI) | Yersinia enterocolitica | CAL10029.1 | 21106126 | |
SS01013 | yopM | yop type III secretion system effector protein (plasmid) (NCBI) | Yersinia enterocolitica | CAL10034.1 | 21106126 | |
SS01015 | yop type III secretion system effector protein (plasmid) (NCBI) | Yersinia enterocolitica | WP_011117630.1 | 21106126 | ||
SS01016 | tccP | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF45424.1 | 21106126 | |
SS01017 | tccP | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF45425.1 | 21106126 | |
SS01018 | tccP | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF45426.1 | 21106126 | |
SS01019 | tccP | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF45427.1 | 21106126 | |
SS01020 | tccP | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF45428.1 | 21106126 | |
SS01021 | tccP | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF45429.1 | 21106126 | |
SS01022 | tccP | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF45430.1 | 21106126 | |
SS01023 | tccP | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF45431.1 | 21106126 | |
SS01024 | tccP | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF45432.1 | 21106126 | |
SS01025 | tccP | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF45433.1 | 21106126 | |
SS01026 | tccP | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF45434.1 | 21106126 | |
SS01027 | tccP | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF45435.1 | 21106126 | |
SS01028 | tccP | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF45436.1 | 21106126 | |
SS01029 | tccP2 | type III secreted effector protein (NCBI) | Escherichia coli | BAF45437.1 | 21106126 | |
SS01030 | tccP2 | type III secreted effector protein (NCBI) | Escherichia coli | BAF45438.1 | 21106126 | |
SS01031 | tccP2 | type III secreted effector protein (NCBI) | Escherichia coli | BAF45439.1 | 21106126 | |
SS01032 | tccP2 | type III secreted effector protein (NCBI) | Escherichia coli | BAF45440.1 | 21106126 | |
SS01033 | tccP2 | type III secreted effector protein (NCBI) | Escherichia coli | BAF45441.1 | 21106126 | |
SS01034 | tccP2 | type III secreted effector protein (NCBI) | Escherichia coli | BAF45442.1 | 21106126 | |
SS01035 | tccP2 | type III secreted effector protein (NCBI) | Escherichia coli | BAF45443.1 | 21106126 | |
SS01036 | tccP2 | type III secreted effector protein (NCBI) | Escherichia coli | BAF45444.1 | 21106126 | |
SS01037 | tccP2 | type III secreted effector protein (NCBI) | Escherichia coli | BAF45445.1 | 21106126 | |
SS01038 | tccP2 | type III secreted effector protein (NCBI) | Escherichia coli | BAF45446.1 | 21106126 | |
SS01039 | tccP2 | type III secreted effector protein (NCBI) | Escherichia coli | BAF45447.1 | 21106126 | |
SS01040 | tccP2 | type III secreted effector protein (NCBI) | Escherichia coli | BAF45448.1 | 21106126 | |
SS01041 | tccP2 | type III secreted effector protein (NCBI) | Escherichia coli | BAF45449.1 | 21106126 | |
SS01042 | tccP2 | type III secreted effector protein (NCBI) | Escherichia coli | BAF45450.1 | 21106126 | |
SS01043 | tccP2 | type III secreted effector protein (NCBI) | Escherichia coli | BAF45451.1 | 21106126 | |
SS01044 | tccP2 | type III secreted effector protein (NCBI) | Escherichia coli | BAF45452.1 | 21106126 | |
SS01045 | tccP2 | type III secreted effector protein (NCBI) | Escherichia coli | BAF45453.1 | 21106126 | |
SS01046 | tccP2 | type III secreted effector protein (NCBI) | Escherichia coli | BAF45454.1 | 21106126 | |
SS01047 | tccP2 | type III secreted effector protein (NCBI) | Escherichia coli | BAF45455.1 | 21106126 | |
SS01048 | tccP2 | type III secreted effector protein (NCBI) | Escherichia coli | BAF45456.1 | 21106126 | |
SS01049 | tccP2 | type III secreted effector protein (NCBI) | Escherichia coli | BAF45457.1 | 21106126 | |
SS01050 | tccP2 | type III secreted effector protein (NCBI) | Escherichia coli | BAF45458.1 | 21106126 | |
SS01051 | tccP2 | type III secreted effector protein (NCBI) | Escherichia coli | BAF45459.1 | 21106126 | |
SS01052 | tccP2 | type III secreted effector protein (NCBI) | Escherichia coli | BAF45460.1 | 21106126 | |
SS01053 | tccP2 | type III secreted effector protein (NCBI) | Escherichia coli | BAF45461.1 | 21106126 | |
SS01054 | tccP2 | type III secreted effector protein (NCBI) | Escherichia coli | BAF45462.1 | 21106126 | |
SS01055 | tccP2 | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF52034.1 | 21106126 | |
SS01056 | tccP2 | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF52035.1 | 21106126 | |
SS01057 | tccP2 | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF52358.1 | 21106126 | |
SS01058 | tccP2 | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF52359.1 | 21106126 | |
SS01059 | tccP2 | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF52360.1 | 21106126 | |
SS01060 | tccP2 | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF52361.1 | 21106126 | |
SS01061 | tccP2 | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF52363.1 | 21106126 | |
SS01062 | tccP2 | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF52364.1 | 21106126 | |
SS01063 | tccP2 | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF52365.1 | 21106126 | |
SS01064 | tccP2 | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF52366.1 | 21106126 | |
SS01065 | tccP2 | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF52367.1 | 21106126 | |
SS01066 | tccP2 | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF52368.1 | 21106126 | |
SS01067 | tccP2 | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF52369.1 | 21106126 | |
SS01068 | tccP2 | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF52370.1 | 21106126 | |
SS01069 | tccP2 | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF52371.1 | 21106126 | |
SS01070 | tccP2 | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF52372.1 | 21106126 | |
SS01071 | tccP2 | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF52373.1 | 21106126 | |
SS01072 | tccP2 | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF52374.1 | 21106126 | |
SS01073 | tccP2 | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF52375.1 | 21106126 | |
SS01074 | tccP2 | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF52376.1 | 21106126 | |
SS01075 | tccP2 | tir-cytoskeleton coupling protein (NCBI) | Escherichia coli | BAF52377.1 | 21106126 | |
SS01076 | tir | translocated intimin receptor Tir (NCBI) | Escherichia coli | BAF52548.1 | 21106126 | |
SS01077 | tir | TTSS effector protein AexT (NCBI) | Escherichia coli | BAF52549.1 | 21106126 | |
SS01078 | aexT | TTSS effector protein AexT (NCBI) | Aeromonas salmonicida | ABO92190.1 | 21106126 | |
SS01079 | hopA1 | HopA1 (NCBI) | Pseudomonas syringae | AAF71481.2 | 21106126 | |
SS01080 | aexT | AexT (NCBI) | Aeromonas piscicola | ABR13262.1 | 21106126 | |
SS01081 | tir | leucine-rich 15-repeat translocated effector protein (plasmid) (NCBI) | Yersinia pestis | ABR14860.1 | 21106126 | |
SS01082 | tir | translocated intimin receptor Tir (NCBI) | Escherichia coli | BAF92845.1 | 21106126 | |
SS01083 | yopM | effector protein YopM (plasmid) (NCBI) | Yersinia pestis | ABX88786.1 | 21106126 | |
SS01084 | nleH | non-LEE-encoded effector NleH (NCBI) | Escherichia coli | BAF96518.1 | 21106126 | |
SS01085 | non-LEE-encoded effector NleG (NCBI) | Escherichia coli | BAF96522.1 | 21106126 | ||
SS01086 | espJ | non-LEE-encoded effector EspJ (NCBI) | Escherichia coli | BAF96525.1 | 21106126 | |
SS01087 | nleH | non-LEE-encoded effector NleH (NCBI) | Escherichia coli | BAF96530.1 | 21106126 | |
SS01088 | espJ | non-LEE-encoded effector EspJ (NCBI) | Escherichia coli | BAF96533.1 | 21106126 | |
SS01089 | nleB | non-LEE-encoded effector NleB (NCBI) | Escherichia coli | BAF96538.1 | 21106126 | |
SS01090 | nleH | non-LEE-encoded effector NleH (NCBI) | Escherichia coli | BAF96539.1 | 21106126 | |
SS01091 | nleG | non-LEE-encoded effector NleG (NCBI) | Escherichia coli | BAF96540.1 | 21106126 | |
SS01092 | nleA | non-LEE-encoded effector NleA (NCBI) | Escherichia coli | BAF96541.1 | 21106126 | |
SS01093 | lcrE | low calcium response protein E (TTSS effector protein) (NCBI) | Chlamydia trachomatis | CAP03784.1 | 21106126 | |
SS01094 | lcrE | low calcium response protein E (TTSS effector protein) (NCBI) | Chlamydia trachomatis | CAP06738.1 | 21106126 | |
SS01095 | serine/threonine-protein kinase (NCBI) | Chlamydia trachomatis | WP_009873285.1 | 21106126 | ||
SS01096 | low calcium response protein E (NCBI) | Chlamydia trachomatis | WP_009873547.1 | 21106126 | ||
SS01097 | Chain A, Crystal Structure Of The C-Terminal Domain Of The Shigella Type Iii Effector Ipah (NCBI) | Chlamydia trachomatis | 3CKD_A | 21106126 | ||
SS01098 | type III secretion effector, YopR family (plasmid) (NCBI) | Pseudomonas fluorescens | ACC91156.1 | 21106126 | ||
SS01099 | secreted effector protein (NCBI) | Salmonella enterica | ACF62143.1 | 21106126 | ||
SS01100 | secreted effector protein (NCBI) | Salmonella enterica | ACF66736.1 | 21106126 | ||
SS01101 | T3SS secreted effector NleB-homolog (NCBI) | Escherichia coli | BAG66368.1 | 21106126 | ||
SS01102 | T3SS secreted effector NleH-homolog (NCBI) | Escherichia coli | BAG66369.1 | 21106126 | ||
SS01103 | T3SS secreted effector NleA-homolog (NCBI) | Escherichia coli | BAG66372.1 | 21106126 | ||
SS01104 | T3SS secreted effector, TccP2 (NCBI) | Escherichia coli | BAG66379.1 | 21106126 | ||
SS01105 | T3SS secreted effector NleF-homolog (NCBI) | Escherichia coli | BAG66565.1 | 21106126 | ||
SS01106 | T3SS secreted effector EspM-homolog (NCBI) | Escherichia coli | BAG66724.1 | 21106126 | ||
SS01107 | T3SS secreted effector NleE-homolog (NCBI) | Escherichia coli | BAG66853.1 | 21106126 | ||
SS01108 | type III secretion system, secreted effector protein (SopE) (NCBI) | Salmonella enterica | CAR37113.1 | 21106126 | ||
SS01109 | type III secretion system, secreted effector protein (SopE) (NCBI) | Salmonella enterica | CAR32737.1 | 21106126 | ||
SS01110 | sspH2 | secreted effector protein (NCBI) | Salmonella enterica | CAR33808.1 | 21106126 | |
SS01111 | Chain A, Structure Of The Cyclomodulin Cif From Pathogenic Escherichia Coli (NCBI) | Salmonella enterica | 3EFY_A | 21106126 | ||
SS01112 | Chain A, Crystal Structure Of The Full Length Ipah3 (NCBI) | Salmonella enterica | 3CVR_A | 21106126 | ||
SS01113 | Chain A, Structure Of The Chromobacterium Violaceum Vira (Spvc) Phosphothreonine Lyase Effector Protein (NCBI) | Salmonella enterica | 3BO6_A | 21106126 | ||
SS01114 | Chain A, Crystal Structure Of Sifa And Skip (NCBI) | Salmonella enterica | 3CXB_A | 21106126 | ||
SS01115 | Chain A, Novel Fold Of Vira, A Type Iii Secretion System Effector Protein From Shigella Flexneri (NCBI) | Salmonella enterica | 3EE1_A | 21106126 | ||
SS01116 | map | Type III secretion system, translocated effector protein, LEE associated (NCBI) | Escherichia coli | CAX18572.1 | 21106126 | |
SS01117 | espH | Type III secretion system, translocated effector protein, LEE associated (NCBI) | Escherichia coli | CAX18574.1 | 21106126 | |
SS01118 | sepZ | Type III secretion system, translocated effector, LEE associated (NCBI) | Escherichia coli | CAX18581.1 | 21106126 | |
SS01119 | map | Type III secretion system, translocated effector protein, LEE associated (NCBI) | Escherichia coli | CAX18647.1 | 21106126 | |
SS01120 | espH | Type III secretion system, translocated effector protein, LEE associated (NCBI) | Escherichia coli | CAX18649.1 | 21106126 | |
SS01121 | map | Type III secretion system, translocated effector protein, LEE associated (NCBI) | Escherichia coli | CAX18727.1 | 21106126 | |
SS01122 | espH | Type III secretion system, translocated effector protein, LEE associated (NCBI) | Escherichia coli | CAX18729.1 | 21106126 | |
SS01123 | sepZ | Type III secretion system, translocated effector, LEE associated (NCBI) | Escherichia coli | CAX18736.1 | 21106126 | |
SS01124 | Chain A, The 2.6 Angstrom Crystal Structure Of Chbp, The Cif Homologue From Burkholderia Pseudomallei (NCBI) | Escherichia coli | 3EIT_A | 21106126 | ||
SS01125 | avrA | type III effector protein (NCBI) | Ralstonia solanacearum | BAH47294.1 | 21106126 | |
SS01126 | popP1 | type III effector protein (NCBI) | Ralstonia solanacearum | BAH47295.1 | 21106126 | |
SS01127 | type III effector protein (NCBI) | Ralstonia solanacearum | BAH47296.1 | 21106126 | ||
SS01128 | ripT | type III effector protein (NCBI) | Ralstonia solanacearum | BAH47297.1 | 21106126 | |
SS01129 | hpx38 | type III effector protein (NCBI) | Ralstonia solanacearum | BAH47298.1 | 21106126 | |
SS01130 | hpx40 | type III effector protein (NCBI) | Ralstonia solanacearum | BAH47300.1 | 21106126 | |
SS01131 | Chain A, The Salmonella Virulence Effector Ssph2 Functions As A Novel E3 Ligase (NCBI) | Ralstonia solanacearum | 3G06_A | 21106126 | ||
SS01132 | lcrE | low calcium response protein E (TTSS effector protein) (NCBI) | Chlamydia trachomatis | CAX09642.1 | 21106126 | |
SS01133 | pkn5 | putative serine/threonine-protein kinase (TTSS effector protein) (NCBI) | Chlamydia trachomatis | CAX10239.1 | 21106126 | |
SS01134 | lcrE | low calcium response protein E (TTSS effector protein) (NCBI) | Chlamydia trachomatis | CAX10536.1 | 21106126 | |
SS01135 | pkn5 | putative serine/threonine-protein kinase (TTSS effector protein) (NCBI) | Chlamydia trachomatis | CAX11132.1 | 21106126 | |
SS01136 | Chain A, Crystal Structure Of Cell Inhibiting Factor (Cif) From Photorhabdus Luminescens (NCBI) | Chlamydia trachomatis | 3GQJ_A | 21106126 | ||
SS01137 | AChain A, Crystal Structure Of Cell Inhibiting Factor (Cif) From Burkholderia Pseudomallei (Cifbp) (NCBI) | Chlamydia trachomatis | 3GQM_A | 21106126 | ||
SS01138 | nleB1 | non-LEE-encoded type III secreted effector (NCBI) | Escherichia coli | ACT70724.1 | 21106126 | |
SS01139 | nleC | non-LEE-encoded type III secreted effector (NCBI) | Escherichia coli | ACT70725.1 | 21106126 | |
SS01140 | nleH1 | non-LEE-encoded type III secreted effector (NCBI) | Escherichia coli | ACT70726.1 | 21106126 | |
SS01141 | nleA | non-LEE-encoded type III secreted effector (NCBI) | Escherichia coli | ACT71538.1 | 21106126 | |
SS01142 | nleH2 | non-LEE-encoded type III secreted effector (NCBI) | Escherichia coli | ACT71540.1 | 21106126 | |
SS01143 | espM1 | non-LEE-encoded type III secreted effector (NCBI) | Escherichia coli | ACT71547.1 | 21106126 | |
SS01144 | espJ | translocated type III secretion system effector (NCBI) | Escherichia coli | ACT72390.1 | 21106126 | |
SS01145 | nleB2 | non-LEE-encoded type III secreted effector (NCBI) | Escherichia coli | ACT73694.1 | 21106126 | |
SS01146 | nleE | non-LEE-encoded type III secreted effector (NCBI) | Escherichia coli | ACT73695.1 | 21106126 | |
SS01147 | espF | LEE-encoded type III secreted effector (NCBI) | Escherichia coli | ACT74386.1 | 21106126 | |
SS01148 | type III secreted effector protein (NCBI) | Escherichia coli | ACT74398.1 | 21106126 | ||
SS01149 | espH | LEE-encoded type III secreted effector (NCBI) | Escherichia coli | ACT74400.1 | 21106126 | |
SS01150 | EspG | LEE-encoded type III secreted effector (NCBI) | Escherichia coli | ACT74425.1 | 21106126 | |
SS01151 | avrE1 | AvrE1 (NCBI) | Pseudomonas syringae | ACU65043.1 | 21106126 | |
SS01152 | hopM1 | HopM1 (NCBI) | Pseudomonas syringae | ACU65060.1 | 21106126 | |
SS01153 | exoU | ExoU (NCBI) | Pseudomonas syringae | ACU65062.1 | 21106126 | |
SS01154 | T3SS secreted effector TccP2 (NCBI) | Escherichia coli | BAI24478.1 | 21106126 | ||
SS01155 | espG | T3SS secreted effector EspG (NCBI) | Escherichia coli | BAI28392.1 | 21106126 | |
SS01156 | espZ | T3SS secreted effector EspZ (NCBI) | Escherichia coli | BAI28410.1 | 21106126 | |
SS01157 | espH | T3SS secreted effector EspH (NCBI) | Escherichia coli | BAI28417.1 | 21106126 | |
SS01158 | map | T3SS secreted effector Map (NCBI) | Escherichia coli | BAI28419.1 | 21106126 | |
SS01159 | espF | T3SS secreted effector EspF (NCBI) | Escherichia coli | BAI28431.1 | 21106126 | |
SS01160 | espF | T3SS secreted effector EspF (NCBI) | Escherichia coli | BAI32323.1 | 21106126 | |
SS01161 | map | T3SS secreted effector Map (NCBI) | Escherichia coli | BAI32335.1 | 21106126 | |
SS01162 | espH | T3SS secreted effector EspH (NCBI) | Escherichia coli | BAI32337.1 | 21106126 | |
SS01163 | espZ | T3SS secreted effector EspZ (NCBI) | Escherichia coli | BAI32344.1 | 21106126 | |
SS01164 | espG | T3SS secreted effector EspG (NCBI) | Escherichia coli | BAI32362.1 | 21106126 | |
SS01165 | espG | T3SS secreted effector EspG (NCBI) | Escherichia coli | BAI37516.1 | 21106126 | |
SS01166 | espF | T3SS secreted effector EspF (NCBI) | Escherichia coli | BAI37519.1 | 21106126 | |
SS01167 | map | T3SS secreted effector Map (NCBI) | Escherichia coli | BAI37531.1 | 21106126 | |
SS01168 | espH | T3SS secreted effector EspH (NCBI) | Escherichia coli | BAI37533.1 | 21106126 | |
SS01169 | espZ | T3SS secreted effector EspZ (NCBI) | Escherichia coli | BAI37540.1 | 21106126 | |
SS01170 | secreted effector protein (NCBI) | Salmonella enterica | CBG25278.1 | 21106126 | ||
SS01171 | yopM | secreted effector protein (plasmid) (NCBI) | Yersinia pestis | ACY60554.1 | 21106126 | |
SS01172 | yopM | secreted effector protein (plasmid) (NCBI) | Yersinia pestis | ACY64328.1 | 21106126 | |
SS01173 | Chain A, Crystal Structure Of The Sifa-skip(ph) Complex (NCBI) | Yersinia pestis | 3HW2_A | 21106126 | ||
SS01174 | eseD | type III secretion system effector protein D (NCBI) | Edwardsiella tarda | ACY83714.1 | 21106126 | |
SS01175 | eseC | type III secretion system effector protein C (NCBI) | Edwardsiella tarda | ACY83715.1 | 21106126 | |
SS01176 | sifA | secreted effector protein (NCBI) | Salmonella enterica | ACY87887.1 | 21106126 | |
SS01177 | sseE | secreted effector protein (NCBI) | Salmonella enterica | ACY88176.1 | 21106126 | |
SS01178 | sifB | secreted effector protein (NCBI) | Salmonella enterica | ACY88411.1 | 21106126 | |
SS01179 | type III secretion effector, YopR family (NCBI) | Yersinia pestis | EFA45613.1 | 21106126 | ||
SS01180 | espS | T3SS effector protein EspS (NCBI) | Citrobacter rodentium | CBG87121.1 | 21106126 | |
SS01181 | espI | T3SS effector protein NleA/EspI (NCBI) | Citrobacter rodentium | CBG87122.1 | 15039354 | |
SS01182 | nleD-1 | T3SS effector protein NleD (NCBI) | Citrobacter rodentium | CBG87356.1 | 21106126 | |
SS01183 | nleB1 | T3SS effector protein NleB1 (NCBI) | Citrobacter rodentium | CBG87859.1 | 21106126 | |
SS01184 | nleE | T3SS effector protein NleE (NCBI) | Citrobacter rodentium | CBG87860.1 | 21106126 | |
SS01185 | nleC | T3SS effector protein NleC (NCBI) | Citrobacter rodentium | CBG88408.1 | 21106126 | |
SS01186 | espG | T3SS effector protein EspG (NCBI) | Citrobacter rodentium | CBG89704.1 | 15039354 | |
SS01187 | espF | T3SS effector protein EspF (NCBI) | Citrobacter rodentium | CBG89706.1 | 15039354 | |
SS01188 | espB | T3SS effector protein EspB (NCBI) | Citrobacter rodentium | CBG89710.1 | 21106126 | |
SS01189 | espD | T3SS translocator protein EspD (NCBI) | Citrobacter rodentium | CBG89711.1 | 21106126 | |
SS01190 | map | T3SS effector protein Map (NCBI) | Citrobacter rodentium | CBG89719.1 | 15039354 | |
SS01191 | espH | T3SS effector protein EspH (NCBI) | Citrobacter rodentium | CBG89721.1 | 15039354 | |
SS01192 | espZ | T3SS effector protein EspZ (NCBI) | Citrobacter rodentium | CBG89728.1 | 21106126 | |
SS01193 | espM3 | T3SS effector protein EspM3 (NCBI) | Citrobacter rodentium | CBG89902.1 | 21106126 | |
SS01194 | nleD-2 | T3SS effector protein NleD (NCBI) | Citrobacter rodentium | CBG90573.1 | 21106126 | |
SS01195 | espT | T3SS effector protein EspT (NCBI) | Citrobacter rodentium | CBG90792.1 | 21106126 | |
SS01196 | nleH | T3SS effector protein NleH (NCBI) | Citrobacter rodentium | CBG91572.1 | 21106126 | |
SS01197 | nleF | T3SS effector protein NleF (NCBI) | Citrobacter rodentium | CBG91573.1 | 21106126 | |
SS01198 | espJ | T3SS effector protein EspJ (NCBI) | Citrobacter rodentium | CBG91576.1 | 21106126 | |
SS01199 | sipA | Type III secretion effector protein SipA (NCBI) | Arsenophonus nasoniae | CBA72793.1 | 21106126 | |
SS01200 | yopB | type III secretion effector protein IpaD, SipD, SspD, YopB (NCBI) | Arsenophonus nasoniae | CBA72795.1 | 21106126 | |
SS01201 | sipB | type III secretion effector protein SipB (NCBI) | Arsenophonus nasoniae | CBA72798.1 | 21106126 | |
SS01202 | yscW | type III secreted effector protein YopN,Yop4b,LcrE,InvE (NCBI) | Arsenophonus nasoniae | CBA73375.1 | 21106126 | |
SS01203 | lcrE | low calcium response protein E (NCBI) | Chlamydia trachomatis | CBJ14605.1 | 21106126 | |
SS01204 | escE | escE protein (NCBI) | Escherichia coli | EKJ11176.1 | 26459509 | |
SS01205 | yscU | YscU (plasmid) (NCBI) | Yersinia enterocolitica | NP_052408.1 | 26338709 | |
SS01206 | nodulation protein NopC (plasmid) (NCBI) | Rhizobium fredii | WP_010875097.1 | 26341483 | ||
SS01207 | nopL | nodulation protein NopL (plasmid) (NCBI) | Rhizobium fredii | WP_010875118.1 | 26341483 | |
SS01208 | YopT-type cysteine protease domain-containing protein (NCBI) | Rhizobium fredii | WP_010875091.1 | 26341483 | ||
SS01209 | nopP | effector protein NopP (NCBI) | Rhizobium fredii | WP_010875098.1 | 26341483 | |
SS01210 | nopE1 | type III effector NopE1 (NCBI) | Bradyrhizobium japonicum | AGH10037.1 | 26341483 | |
SS01211 | nopE2 | type III effector NopE2 (NCBI) | Bradyrhizobium japonicum | AGH10050.1 | 26341483 | |
SS01212 | histidine kinase (NCBI) | Streptomyces | WP_030419593.1 | 26341483 | ||
SS01213 | exoT | ExoT (NCBI) | Sinorhizobium meliloti | CAA80362.1 | 26451042 | |
SS01215 | espD | EspD (Reference, NCBI) | Edwardsiella sp. | AJK93307.1 | 28351918;26324713 | |
SS01216 | nleE | NleE (NCBI) | Escherichia coli | AJA27980.1 | 26096513 | |
SS01217 | nleC | T3SS effector protein NleC (NCBI) | Escherichia coli | AHY70515.1 | 26096513 | |
SS01218 | sboH | SboH (Reference); Chimeric type III secretion system effector protein (NCBI) | Salmonella bongori | CCC30955.1 | 21876672;25756944 | |
SS01219 | YopK (plasmid) (NCBI) | Yersinia pseudotuberculosis | WP_011191373.1 | 25691590 | ||
SS01220 | bprD | BprD protein (NCBI) | Burkholderia pseudomallei | CPN43953.1 | 25635268 | |
SS01221 | eppA | exported protein A EppA (NCBI) | Borrelia burgdorferi | WP_010883763.1 | 25635268 | |
SS01222 | nleB | NleB (NCBI) | Escherichia coli | ADD55598.1 | 25536377 | |
SS01223 | nleF | T3SS effector protein NleF (NCBI) | Escherichia coli | AHY71029.1 | 25183730 | |
SS01224 | CDSF (NCBI) | Mycoplasma agalactiae | CBH40896.1 | 24959658 | ||
SS01225 | nleD | non-LEE-encoded type III secreted effector, NleD (NCBI) | Escherichia coli | AIF92441.1 | 24733098 | |
SS01226 | YopM; putative targeted effector protein (plasmid) (NCBI) | Pseudomonas fluorescens | ACC91213.1 | 24636859 | ||
SS01227 | VPA0450 (Reference); VPA0450 family T3SS effector inositol phosphatase (NCBI) | Vibrio parahaemolyticus | WP_005479246.1 | 24606036 | ||
SS01228 | yopJ | type III secretion system effector acetyltransferase YopJ (NCBI) | Yersinia pseudotuberculosis | WP_002225474.1 | 24199174 | |
SS01229 | aexT | AexT, partial (NCBI) | Aeromonas veronii | ACU24693.1 | 24073886 | |
SS01230 | aopP | AopP (Reference); AopP (plasmid) (NCBI) | Aeromonas salmonicida | YP_009062872.1 | 24073886 | |
SS02422 | RSp0731 | Probable trehalose-6-phosphate synthase (Alpha,alpha-trehalose-phosphate synthase udp-forming) protein (UniProt, NCBI) | Ralstonia solanacearum | Q8XRV0 | CAD17882.1 | 25538193 |
SS02423 | BPSS1521 | hypothetical protein BMAA1518 (NCBI) | Burkholderia pseudomallei | Q63K45 | AAU46031.1 | 25635268 |
SS02424 | XCVd0086 | hypothetical protein XCVd0086 (NCBI) | Xanthomonas campestris | Q3C018 | CAJ19898.1 | 26104875 |
SS02425 | rip60 | Ankyrin repeat domain-containing protein (UniProt, NCBI) | Ralstonia solanacearum | D2YZZ9 | WP_016725077.1 | 20121447 |
SS02426 | XOO4042 | DUF1615 domain-containing protein (NCBI) | Xanthomonas oryzae | Q5GVH7 | WP_011260398.1 | 27084974 |
SS02427 | mvpA | tRNA(fMet)-specific endonuclease VapC (UniProt) | Shigella flexneri | Q7BEJ1 | O06662.1 | 29073283 |
SS02428 | pWR501_0063 | hypothetical protein pWR501_0063 (NCBI) | Shigella flexneri | Q7BEG8 | NP_085218.1 | 29073283 |
SS02429 | pWR501_0112 | hypothetical protein pWR501_0112 (NCBI) | Shigella flexneri | Q9AFT7 | NP_085266.1 | 29073283 |
SS02430 | XCV1197 | XopAV (Reference); conserved hypothetical protein (NCBI) | Xanthomonas campestris | Q3BWD5 | CAJ22828.1 | 26104875 |
SS02431 | yggG | YggG (Reference); Putative metalloprotease yggG (NCBI) | Salmonella enterica | Q7CPU3 | EFX50805.1 | |
SS02432 | RxL23 | HaRxL23 (Reference); RxLR effector candidate (UniProt) | Hyaloperonospora arabidopsidis | G3C9N9 | CCC55815.1 | 29641586 |
SS02450 | innB | InnB (UniProt, NCBI) | Bradyrhizobium elkanii | A0A384VCK8 | ASR87851.1 | 30619219 |
SS02451 | XC_4273 (XCC4186) | XopLXcc8004 (Reference) | Xanthomonas campestris pv. campestris str. 8004 | Q8P390 | AAY51309.1 | 30594633 |
SS02452 | bel2-5 | BEL2_5 (UniProt, NCBI) | Bradyrhizobium elkanii | A0A0K0WSG7 | AKS25901.1 | 32349348 |
SS02453 | nopP_2 | Effector protein NopP (UniProt, NCBI) | Bradyrhizobium sp. CI-1B | A0A508T046 | WP_139859047.1 | 32349348 |
SS02454 | AG1IA_05142 | AGLIP1 (Reference) | Rhizoctonia solani AG-1 IA | L8WVP3 | ELU40828.1 | 31611861 |
SS02455 | APS58_0500 | hypothetical protein APS58_0500 (NCBI) | Acidovorax citrulli | QCX09454.1 | 31643123 | |
SS02456 | APS58_1000 | hypothetical protein APS58_1000 (NCBI) | Acidovorax citrulli | QCX09914.1 | 31643123 | |
SS02457 | APS58_1448 | hypothetical protein APS58_1448 (NCBI) | Acidovorax citrulli | QCX10339.1 | 31643123 | |
SS02458 | APS58_2974 | hypothetical protein APS58_2974 (NCBI) | Acidovorax citrulli | QCX11767.1 | 31643123 | |
SS02459 | APS58_3297 | hypothetical protein APS58_3297 (NCBI) | Acidovorax citrulli | QCX12068.1 | 31643123 | |
SS02460 | APS58_4095 | hypothetical protein APS58_4095 (NCBI) | Acidovorax citrulli | QCX12800.1 | 31643123 | |
SS02461 | APS58_4116 | hypothetical protein APS58_4116 (NCBI) | Acidovorax citrulli | QCX12820.1 | 31643123 |
T4SS substrate
BastionHub ID | Gene Name | Brief Description
![]() |
Species | UniProt ID | NCBI ID | PubMed ID |
---|---|---|---|---|---|---|
SS01231 | lpg1689 | lpg1689 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | P37033 | WP_010947416.1 | 24064423 |
SS01232 | drrA | Multifunctional virulence effector protein DrrA (UniProt, NCBI) | Legionella pneumophila | Q29ST3 | WP_010948166.1 | |
SS01233 | lubX | E3 ubiquitin-protein ligase LubX (UniProt, NCBI) | Legionella pneumophila | Q5X159 | Q5X159.1 | |
SS01234 | lpg3000 | lpg3000 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZR83 | WP_010948684.1 | 24064423 |
SS01235 | legP | Dot/Icm T4SS effector LegP (NCBI) | Legionella pneumophila | Q5ZR84 | WP_010948683.1 | 24064423 |
SS01236 | lpg2975 | lpg2975 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZRA8 | WP_010948659.1 | 24064423 |
SS01237 | lpg2936 | Ribosomal RNA small subunit methyltransferase E (UniProt) | Legionella pneumophila | Q5ZRE6 | 24064423 | |
SS01238 | lpg2912 | lpg2912 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZRH0 | 24064423 | |
SS01239 | lpg2907 | hypothetical protein lpg2907 (NCBI) | Legionella pneumophila | Q5ZRH5 | AAU28953.1 | 24064423 |
SS01240 | lpg2888 | lpg2888 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZRJ3 | WP_010948574.1 | 24064423 |
SS01241 | lpg2885 | lpg2885 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZRJ6 | WP_010948571.1 | 24064423 |
SS01242 | lpg2884 | lpg2884 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZRJ7 | WP_010948570.1 | 24064423 |
SS01243 | lpg2879 | lpg2879 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZRK2 | WP_010948565.1 | 24064423 |
SS01244 | lpg2874 | lpg2874 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZRK7 | WP_010948560.1 | 24064423 |
SS01245 | lpg2844 | lpg2844 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZRN6 | WP_010948531.1 | 24064423 |
SS01246 | lpg2832 | lpg2832 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZRP8 | WP_010948519.1 | 24064423 |
SS01247 | lpg2831 | Dot/Icm type IV secretion system effector VipD (NCBI) | Legionella pneumophila | Q5ZRP9 | WP_010948518.1 | 24064423 |
SS01248 | lubX | E3 ubiquitin-protein ligase LubX (UniProt, NCBI) | Legionella pneumophila | Q5ZRQ0 | 24064423 | |
SS01249 | sidH | SidH (UniProt) | Legionella pneumophila | Q5ZRQ1 | WP_010948516.1 | 24064423 |
SS01250 | lpg2828 | lpg2828 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZRQ2 | WP_010948515.1 | 24064423 |
SS01251 | lpg2826 | Dot/Icm T4SS effector Ceg34 (NCBI) | Legionella pneumophila | Q5ZRQ4 | WP_010948513.1 | 24064423 |
SS01252 | lpg2815 | T4SS effector ferrous iron transporter IroT/MavN (NCBI) | Legionella pneumophila | Q5ZRR5 | WP_010948502.1 | 24064423 |
SS01253 | lpg2806 | hypothetical protein lpg2806 (NCBI) | Legionella pneumophila | Q5ZRS4 | AAU28854.1 | 24064423 |
SS01254 | lpg2804 | Dot/Icm T4SS effector Lem29 (NCBI) | Legionella pneumophila | Q5ZRS6 | WP_010948491.1 | 24064423 |
SS01255 | lepA | Dot/Icm type IV secretion system effector LepA (NCBI) | Legionella pneumophila | Q5ZRT5 | WP_010948481.1 | 24064423 |
SS01256 | lpg2745 | lpg2745 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZRX6 | WP_010948443.1 | 24064423 |
SS01257 | lpg2744 | lpg2744 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZRX7 | WP_010948442.1 | 24064423 |
SS01258 | lpg2692 | lpg2692 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZS27 | WP_010948392.1 | 24064423 |
SS01259 | lpg2637 | lpg2637 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZS82 | WP_010948337.1 | 24064423 |
SS01260 | lpg2628 | lpg2628 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZS91 | WP_010948328.1 | 24064423 |
SS01261 | lpg2603 | Dot/Icm T4SS effector Lem28 (NCBI) | Legionella pneumophila | Q5ZSB6 | WP_010948303.1 | 24064423 |
SS01262 | lpg2591 | Dot/Icm T4SS effector Ceg33 (NCBI) | Legionella pneumophila | Q5ZSC8 | WP_010948291.1 | 24064423 |
SS01263 | sidF | SidF, inhibitor of growth family, member 3 (UniProt) | Legionella pneumophila | Q5ZSD5 | WP_010948284.1 | 24064423 |
SS01264 | lpg2577 | Dot/Icm T4SS effector MavM (NCBI) | Legionella pneumophila | Q5ZSE2 | WP_010948277.1 | 24064423 |
SS01265 | lpg2555 | Lpg2555 family Dot/Icm T4SS effector hydrolase (NCBI) | Legionella pneumophila | Q5ZSG2 | WP_010948257.1 | 24064423 |
SS01266 | lpg2552 | lpg2552 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZSG5 | WP_010948254.1 | 24064423 |
SS01267 | lpg2546 | lpg2546 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZSH1 | WP_010948248.1 | 24064423 |
SS01268 | lpg2541 | lpg2541 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZSH6 | WP_010948243.1 | 24064423 |
SS01269 | lpg2539 | lpg2539 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZSH8 | WP_010948241.1 | 24064423 |
SS01270 | lpg2538 | lpg2538 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZSH9 | WP_010948240.1 | 24064423 |
SS01271 | lpg2529 | Dot/Icm T4SS effector Lem27 (NCBI) | Legionella pneumophila | Q5ZSI8 | WP_010948231.1 | 24064423 |
SS01272 | lpg2527 | lpg2527 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZSJ0 | WP_010948229.1 | 24064423 |
SS01273 | lpg2526 | Dot/Icm T4SS effector MavL (NCBI) | Legionella pneumophila | Q5ZSJ1 | WP_010948228.1 | 24064423 |
SS01274 | lpg2525 | lpg2525 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZSJ2 | WP_010948227.1 | 24064423 |
SS01275 | lpg2523 | Dot/Icm T4SS effector Lem26 (NCBI) | Legionella pneumophila | Q5ZSJ4 | WP_010948225.1 | 24064423 |
SS01276 | sidC | SidC, interaptin (UniProt) | Legionella pneumophila | Q5ZSK6 | WP_010948213.1 | 24064423 |
SS01277 | lpg2509 | SdeD (UniProt) | Legionella pneumophila | Q5ZSK8 | Dot/Icm T4SS effector deubiquitinase DupB/LaiF | 24064423 |
SS01278 | lpg2505 | Chain A, MesI (Lpg2505) (NCBI) | Legionella pneumophila | Q5ZSL2 | 6YVG_A | 24064423 |
SS01279 | lpg2504 | Dot/Icm T4SS effector Ceg32/SidI (NCBI) | Legionella pneumophila | Q5ZSL3 | WP_010948206.1 | 24064423 |
SS01280 | lpg2498 | DUF5636 domain-containing protein (UniProt) | Legionella pneumophila | Q5ZSL9 | WP_010948200.1 | 24064423 |
SS01281 | lepB | LepB (UniProt) | Legionella pneumophila | Q5ZSM7 | WP_010948192.1 | 24064423 |
SS01282 | lpg2482 | SdbC (UniProt) | Legionella pneumophila | Q5ZSN5 | WP_010948184.1 | 24064423 |
SS01283 | sidD | Adenosine monophosphate-protein hydrolase SidD (UniProt) | Legionella pneumophila | Q5ZSQ2 | WP_010948167.1 | 24064423 |
SS01284 | drrA | Multifunctional virulence effector protein DrrA (UniProt, NCBI) | Legionella pneumophila | Q5ZSQ3 | WP_010948166.1 | 24064423 |
SS01285 | lpg2461 | lpg2461 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZSQ6 | WP_010948163.1 | 24064423 |
SS01286 | legA15 | Dot/Icm T4SS effector AnkD/LegA15 (NCBI) | Legionella pneumophila | Q5ZSR1 | WP_010948158.1 | 24064423 |
SS01287 | legA14 | Dot/Icm T4SS effector AnkF/LegA14/Ceg31 (NCBI) | Legionella pneumophila | Q5ZSR5 | WP_010948154.1 | 24064423 |
SS01288 | lpg2444 | Dot/Icm T4SS effector MavI (NCBI) | Legionella pneumophila | Q5ZSS2 | WP_010948147.1 | 24064423 |
SS01289 | lpg2443 | lpg2443 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZSS3 | WP_010948146.1 | 24064423 |
SS01290 | lpg2434 | lpg2434 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZST2 | WP_010948137.1 | 24064423 |
SS01291 | lpg2425 | Dot/Icm T4SS effector MavH (NCBI) | Legionella pneumophila | Q5ZSU1 | WP_010948128.1 | 24064423 |
SS01292 | lpg2424 | Dot/Icm T4SS effector MavG (NCBI) | Legionella pneumophila | Q5ZSU2 | WP_010948127.1 | 24064423 |
SS01293 | lpg2422 | Dot/Icm T4SS effector Lem25 (NCBI) | Legionella pneumophila | Q5ZSU4 | WP_010948125.1 | 24064423 |
SS01294 | lpg2420 | Lpg2420 family Dot/Icm T4SS effector N-acetyltransferase (NCBI) | Legionella pneumophila | Q5ZSU6 | WP_010948124.1 | 24064423 |
SS01295 | lpg2411 | Dot/Icm T4SS effector Lem24 (NCBI) | Legionella pneumophila | Q5ZSV5 | WP_010948115.1 | 24064423 |
SS01296 | lpg2409 | Dot/Icm type IV secretion system effector Ceg29 (NCBI) | Legionella pneumophila | Q5ZSV7 | WP_010948113.1 | 24064423 |
SS01297 | lpg2407 | lpg2407 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZSV9 | WP_010948111.1 | 24064423 |
SS01298 | lpg2406 | Dot/Icm T4SS effector Lem23 (NCBI) | Legionella pneumophila | Q5ZSW0 | WP_010948110.1 | 24064423 |
SS01299 | lpg2382 | lpg2382 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZSY4 | WP_010948086.1 | 24064423 |
SS01300 | lpg2375 | hypothetical protein lpg2375 (NCBI) | Legionella pneumophila | Q5ZSZ1 | AAU28436.1 | 24064423 |
SS01301 | lpg2372 | lpg2372 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZSZ4 | WP_010948076.1 | 24064423 |
SS01302 | lpg2370 | lpg2370 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZSZ6 | WP_010948074.1 | 24064423 |
SS01303 | lpg2359 | lpg2359 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZT06 | WP_010948065.1 | 24064423 |
SS01304 | lpg2351 | Dot/Icm T4SS effector MavF (NCBI) | Legionella pneumophila | Q5ZT14 | WP_010948057.1 | 24064423 |
SS01305 | lpg2344 | Dot/Icm T4SS effector MavE (NCBI) | Legionella pneumophila | Q5ZT21 | WP_010948050.1 | 24064423 |
SS01306 | lpg2328 | Dot/Icm T4SS effector Lem22 (NCBI) | Legionella pneumophila | Q5ZT37 | WP_010948034.1 | 24064423 |
SS01307 | legA5 | Dot/Icm T4SS effector AnkK/LegA5 (NCBI) | Legionella pneumophila | Q5ZT43 | WP_010948028.1 | 24064423 |
SS01308 | lpg2311 | Dot/Icm T4SS effector Ceg28 (NCBI) | Legionella pneumophila | Q5ZT54 | WP_010948017.1 | 24064423 |
SS01309 | legA3 | Dot/Icm T4SS effector AnkH/LegA3 (NCBI) | Legionella pneumophila | Q5ZT65 | WP_010948006.1 | 24064423 |
SS01310 | legC7 | Inclusion membrane protein A (UniProt) | Legionella pneumophila | Q5ZT67 | WP_010948004.1 | 24064423 |
SS01311 | lpg2283 | hypothetical protein lpg2283 (NCBI) | Legionella pneumophila | Q5ZT79 | AAU28348.1 | 24064423 |
SS01312 | lpg2271 | lpg2271 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZT91 | WP_010947980.1 | 24064423 |
SS01313 | lpg2248 | Dot/Icm T4SS effector Lem21 (NCBI) | Legionella pneumophila | Q5ZTB4 | WP_010947957.1 | 24064423 |
SS01314 | lpg2244 | hypothetical protein lpg2244 (NCBI) | Legionella pneumophila | Q5ZTB8 | AAU28309.1 | 24064423 |
SS01315 | lpg2239 | lpg2239 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZTC3 | WP_010947948.1 | 24064423 |
SS01316 | lpg2223 | lpg2223 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZTD9 | WP_010947932.1 | 24064423 |
SS01317 | lpg2216 | Purine NTPase, putative (UniProt) | Legionella pneumophila | Q5ZTE6 | 24064423 | |
SS01318 | legA2 | Dot/Icm type IV secretion system effector LegA2 (NCBI) | Legionella pneumophila | Q5ZTE7 | 24064423 | |
SS01319 | lpg2200 | Dot/Icm T4SS effector CegC4 (NCBI) | Legionella pneumophila | Q5ZTG2 | WP_010947909.1 | 24064423 |
SS01320 | lpg2199 | Dot/Icm T4SS effector CegC4 (NCBI) | Legionella pneumophila | Q5ZTG3 | WP_010947908.1 | 24064423 |
SS01321 | lpg2176 | Dot/Icm T4SS effector sphingosine 1-phosphate lyase LegS2 (NCBI) | Legionella pneumophila | Q5ZTI6 | WP_010947885.1 | 24064423 |
SS01322 | lpg2166 | Dot/Icm T4SS effector Lem19 (NCBI) | Legionella pneumophila | Q5ZTJ5 | WP_010947877.1 | 24064423 |
SS01323 | lpg2164 | hypothetical protein lpg2164 (NCBI) | Legionella pneumophila | Q5ZTJ7 | AAU28230.1 | 24064423 |
SS01324 | lpg2160 | lpg2160 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZTK1 | WP_010947871.1 | 24064423 |
SS01325 | sidJ | T4SS meta-effector polyglutamylase SidJ (NCBI) | Legionella pneumophila | Q5ZTK6 | WP_010947866.1 | 24064423 |
SS01326 | lpg2153 | Dot/Icm T4SS effector SdeC/LaiC (NCBI) | Legionella pneumophila | Q5ZTK8 | WP_010947864.1 | 24064423 |
SS01327 | lpg2149 | lpg2149 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZTL2 | WP_010947860.1 | 24064423 |
SS01328 | lpg2147 | Dot/Icm T4SS effector MavC (NCBI) | Legionella pneumophila | Q5ZTL4 | WP_010947858.1 | 24064423 |
SS01329 | legAU13 | F-box/ankyrin repeat-containing T4SS effector AnkB (NCBI) | Legionella pneumophila | Q5ZTL7 | PNL77506.1 | 24064423 |
SS01330 | legK2 | Dot/Icm T4SS effector LegK2 (NCBI) | Legionella pneumophila | Q5ZTM4 | WP_010947848.1 | 24064423 |
SS01331 | lpg2050 | lpg2050 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZTV8 | WP_010947766.1 | 24064423 |
SS01332 | lpg1986 | lpg1986 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZU22 | WP_010947702.1 | 24064423 |
SS01333 | setA | Subversion of eukaryotic traffic protein A (UniProt) | Legionella pneumophila | Q5ZU30 | WP_010947694.1 | 24064423 |
SS01334 | legG1 | UVB-resistance protein UVR8 (UniProt) | Legionella pneumophila | Q5ZU32 | WP_010947692.1 | 24064423 |
SS01335 | lpg1972 | Dot/Icm T4SS effector PieF (NCBI) | Legionella pneumophila | Q5ZU36 | WP_010947688.1 | 24064423 |
SS01336 | lpg1969 | Dot/Icm T4SS effector PieE (NCBI) | Legionella pneumophila | Q5ZU39 | WP_010947685.1 | 24064423 |
SS01337 | lpg1965 | Dot/Icm T4SS effector PieC/LirE (NCBI) | Legionella pneumophila | Q5ZU43 | WP_010947681.1 | 24064423 |
SS01338 | lpg1964 | Dot/Icm T4SS effector PieB/LirD (NCBI) | Legionella pneumophila | Q5ZU44 | WP_010947680.1 | 24064423 |
SS01339 | lpg1963 | Dot/Icm T4SS effector PieA/LirC (NCBI) | Legionella pneumophila | Q5ZU45 | WP_010947679.1 | 24064423 |
SS01340 | lpg1962 | peptidyl-prolyl cis-trans isomerase A (cyclophilin A) (NCBI) | Legionella pneumophila | Q5ZU46 | AGN14841.1 | 24064423 |
SS01341 | lpg1960 | Dot/Icm T4SS effector LirA (NCBI) | Legionella pneumophila | Q5ZU48 | WP_010947676.1 | 24064423 |
SS01342 | lpg1959 | lpg1959 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZU49 | WP_010947675.1 | 24064423 |
SS01343 | legC4 | Dot/Icm T4SS effector LegC4 (NCBI) | Legionella pneumophila | Q5ZU55 | WP_010947669.1 | 24064423 |
SS01344 | sec7 | T4SS guanine nucleotide exchange effector RalF (NCBI) | Legionella pneumophila | Q5ZU58 | WP_010947666.1 | 24064423 |
SS01345 | lpg1949 | Dot/Icm T4SS effector Lem17 (NCBI) | Legionella pneumophila | Q5ZU59 | WP_010947665.1 | 24064423 |
SS01346 | legLC4 | Dot/Icm T4SS effector LegLC4 (NCBI) | Legionella pneumophila | Q5ZU60 | WP_010947664.1 | 24064423 |
SS01347 | lpg1947 | Dot/Icm T4SS effector Lem16 (NCBI) | Legionella pneumophila | Q5ZU61 | WP_010947663.1 | 24064423 |
SS01348 | lpg1933 | Dot/Icm T4SS effector Lem15 (NCBI) | Legionella pneumophila | Q5ZU75 | WP_010947649.1 | 24064423 |
SS01349 | lpg1924 | lpg1924 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZU83 | WP_010947641.1 | 24064423 |
SS01350 | lpg1907 | lpg1907 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZUA0 | WP_010947624.1 | 24064423 |
SS01351 | legLC8 | Dot/Icm T4SS effector LegLC8 (NCBI) | Legionella pneumophila | Q5ZUB7 | WP_010947607.1 | 24064423 |
SS01352 | lpg1888 | Lpg1888 family Dot/Icm type IV secretion system effector (NCBI) | Legionella pneumophila | Q5ZUB9 | WP_010947605.1 | 24064423 |
SS01353 | lpg1851 | Dot/Icm T4SS effector Lem14 (NCBI) | Legionella pneumophila | Q5ZUE7 | WP_010947577.1 | 24064423 |
SS01354 | lpg1836 | Dot/Icm T4SS effector Ceg25 (NCBI) | Legionella pneumophila | Q5ZUG2 | WP_010947562.1 | 24064423 |
SS01355 | lpg1822 | hypothetical protein lpg1822 (NCBI) | Legionella pneumophila | Q5ZUH6 | AAU27901.1 | 24064423 |
SS01356 | lpg1803 | lpg1803 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZUJ5 | WP_010947529.1 | 24064423 |
SS01357 | lpg1798 | Dot/Icm T4SS effector MavB (NCBI) | Legionella pneumophila | Q5ZUK0 | WP_010947524.1 | 24064423 |
SS01358 | lpg1797 | Dot/Icm T4SS effector RvfA (NCBI) | Legionella pneumophila | Q5ZUK1 | WP_010947523.1 | 24064423 |
SS01359 | lpg1776 | lpg1776 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZUL7 | WP_010947502.1 | 24064423 |
SS01360 | lpg1752 | lpg1752 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZUP1 | WP_010947478.1 | 24064423 |
SS01361 | lpg1751 | lpg1751 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZUP2 | WP_010947477.1 | 24064423 |
SS01362 | legAS4 | Eukaryotic huntingtin interacting protein B (UniProt) | Legionella pneumophila | Q5ZUS4 | WP_010947445.1 | 24064423 |
SS01363 | lpg1717 | lpg1717 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZUS5 | WP_010947444.1 | 24064423 |
SS01364 | lpg1716 | lpg1716 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZUS6 | WP_010947443.1 | 24064423 |
SS01365 | lpg1692 | lpg1692 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZUV0 | WP_010947419.1 | 24064423 |
SS01366 | lpg1687 | Dot/Icm T4SS effector MavA (NCBI) | Legionella pneumophila | Q5ZUV5 | WP_010947414.1 | 24064423 |
SS01367 | lpg1685 | lpg1685 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZUV7 | WP_010947412.1 | 24064423 |
SS01368 | lpg1684 | lpg1684 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZUV8 | WP_010947411.1 | 24064423 |
SS01369 | lpg1683 | Dot/Icm T4SS effector RavZ (NCBI) | Legionella pneumophila | Q5ZUV9 | WP_010947410.1 | 24064423 |
SS01370 | lpg1670 | lpg1670 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZUX2 | WP_010947397.1 | 24064423 |
SS01371 | lpg1667 | lpg1667 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZUX5 | WP_010947394.1 | 24064423 |
SS01372 | lpg1666 | lpg1666 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZUX6 | WP_010947393.1 | 24064423 |
SS01373 | lpg1663 | hypothetical protein lpg1663 (NCBI) | Legionella pneumophila | Q5ZUX9 | AAU27743.1 | 24064423 |
SS01374 | lpg1661 | lpg1661 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZUY1 | WP_010947388.1 | 24064423 |
SS01375 | legL3 | Dot/Icm T4SS effector LegL3 (NCBI) | Legionella pneumophila | Q5ZUY2 | WP_010947387.1 | 24064423 |
SS01376 | lpg1654 | lpg1654 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZUY8 | WP_010947381.1 | 24064423 |
SS01377 | sidB | SidB (UniProt) | Legionella pneumophila | Q5ZV00 | WP_010947369.1 | 24064423 |
SS01378 | lpg1639 | lpg1639 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZV03 | WP_010947366.1 | 24064423 |
SS01379 | lpg1625 | Dot/Icm T4SS effector Lem12 (NCBI) | Legionella pneumophila | Q5ZV17 | WP_010947352.1 | 24064423 |
SS01380 | lpg1621 | Dot/Icm T4SS effector Ceg23 (NCBI) | Legionella pneumophila | Q5ZV21 | WP_010947348.1 | 24064423 |
SS01381 | lpg1598 | Dot/Icm T4SS effector Lem11 (NCBI) | Legionella pneumophila | Q5ZV42 | WP_010947327.1 | 24064423 |
SS01382 | legC6 | Dot/Icm T4SS effector LegC6 (NCBI) | Legionella pneumophila | Q5ZV52 | WP_010947317.1 | 24064423 |
SS01383 | lpg1578 | lpg1578 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZV62 | WP_010947307.1 | 24064423 |
SS01384 | lpg1551 | Dot/Icm T4SS effector RavY (NCBI) | Legionella pneumophila | Q5ZV89 | WP_010947280.1 | 24064423 |
SS01385 | lpg1496 | Dot/Icm T4SS effector Lem10 (NCBI) | Legionella pneumophila | Q5ZVE4 | WP_010947225.1 | 24064423 |
SS01386 | lpg1491 | Dot/Icm T4SS effector Lem9 (NCBI) | Legionella pneumophila | Q5ZVE9 | WP_010947220.1 | 24064423 |
SS01387 | lpg1489 | Dot/Icm T4SS effector RavX (NCBI) | Legionella pneumophila | Q5ZVF1 | WP_010947218.1 | 24064423 |
SS01388 | legC5 | Dot/Icm type IV secretion system effector Lgt3/LegC5 (NCBI) | Legionella pneumophila | Q5ZVF2 | WP_010947217.1 | 24064423 |
SS01389 | lpg1484 | lpg1484 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZVF6 | WP_010947213.1 | 24064423 |
SS01390 | legK1 | Dot/Icm type IV secretion system effector kinase LegK1 (NCBI) | Legionella pneumophila | Q5ZVF7 | WP_010947212.1 | 24064423 |
SS01391 | lpg1453 | lpg1453 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZVI7 | WP_010947182.1 | 24064423 |
SS01392 | lpg1449 | lpg1449 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZVJ1 | WP_010947178.1 | 24064423 |
SS01393 | lpg1426 | Dot/Icm T4SS effector VpdC (NCBI) | Legionella pneumophila | Q5ZVL4 | WP_010947155.1 | 24064423 |
SS01394 | licA | Choline kinase (UniProt) | Legionella pneumophila | Q5ZVN2 | WP_010947137.1 | 24064423 |
SS01395 | lpg1356 | TPR repeat protein (UniProt) | Legionella pneumophila | Q5ZVT4 | WP_010947086.1 | 24064423 |
SS01396 | sidG | SidG (UniProt) | Legionella pneumophila | Q5ZVT5 | WP_010947085.1 | 24064423 |
SS01397 | lpg1354 | hypothetical protein lpg1354 (NCBI) | Legionella pneumophila | Q5ZVT6 | AAU27436.1 | 24064423 |
SS01398 | lpg1316 | Dot/Icm T4SS effector RavT (NCBI) | Legionella pneumophila | Q5ZVX2 | WP_010947047.1 | 24064423 |
SS01399 | legC1 | Dot/Icm T4SS effector LegC1 (NCBI) | Legionella pneumophila | Q5ZVX6 | WP_010947043.1 | 24064423 |
SS01400 | lpg1290 | Dot/Icm T4SS effector Lem8 (NCBI) | Legionella pneumophila | Q5ZVZ8 | WP_010947021.1 | 24064423 |
SS01401 | lpg1273 | lpg1273 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZW15 | WP_010947004.1 | 24064423 |
SS01402 | lpg1227 | Dot/Icm T4SS effector VpdB (NCBI) | Legionella pneumophila | Q5ZW60 | WP_010946959.1 | 24064423 |
SS01403 | lpg1183 | Dot/Icm T4SS effector RavS (NCBI) | Legionella pneumophila | Q5ZWA2 | WP_010946917.1 | 24064423 |
SS01404 | lpg1171 | lpg1171 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZWB4 | WP_010946905.1 | 24064423 |
SS01405 | lpg1166 | Dot/Icm T4SS effector RavR (NCBI) | Legionella pneumophila | Q5ZWB9 | WP_010946900.1 | 24064423 |
SS01406 | lpg1158 | lpg1158 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZWC7 | WP_010946892.1 | 24064423 |
SS01407 | lpg1154 | Dot/Icm T4SS effector RavQ (NCBI) | Legionella pneumophila | Q5ZWD1 | WP_010946888.1 | 24064423 |
SS01408 | lpg1152 | Dot/Icm T4SS effector RavP (NCBI) | Legionella pneumophila | Q5ZWD3 | WP_010946886.1 | 24064423 |
SS01409 | lpg1148 | lpg1148 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZWD7 | WP_010946882.1 | 24064423 |
SS01410 | lpg1145 | Dot/Icm T4SS effector Lem7 (NCBI) | Legionella pneumophila | Q5ZWE0 | WP_010946879.1 | 24064423 |
SS01411 | lpg1144 | Dot/Icm T4SS effector CegC3 (NCBI) | Legionella pneumophila | Q5ZWE1 | WP_010946878.1 | 24064423 |
SS01412 | lpg1137 | lpg1137 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZWE8 | WP_010946871.1 | 24064423 |
SS01413 | lpg1129 | Dot/Icm T4SS effector RavO (NCBI) | Legionella pneumophila | Q5ZWF6 | WP_010946863.1 | 24064423 |
SS01414 | lpg1124 | lpg1124 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZWG1 | WP_010946858.1 | 24064423 |
SS01415 | lpg1121 | Dot/Icm T4SS effector Ceg19 (NCBI) | Legionella pneumophila | Q5ZWG4 | WP_010946855.1 | 24064423 |
SS01416 | lpg1111 | Dot/Icm T4SS effector RavN (NCBI) | Legionella pneumophila | Q5ZWH4 | WP_010946845.1 | 24064423 |
SS01417 | lpg1110 | Dot/Icm T4SS effector Lem5 (NCBI) | Legionella pneumophila | Q5ZWH5 | WP_010946844.1 | 24064423 |
SS01418 | lpg1109 | Dot/Icm T4SS effector RavM (NCBI) | Legionella pneumophila | Q5ZWH6 | WP_010946843.1 | 24064423 |
SS01419 | lpg1108 | Dot/Icm type IV secretion system effector RavL (NCBI) | Legionella pneumophila | Q5ZWH7 | WP_010946842.1 | 24064423 |
SS01420 | lpg1106 | lpg1106 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZWH9 | WP_010946840.1 | 24064423 |
SS01421 | lpg1101 | Dot/Icm T4SS effector Lem4/SmdA (NCBI) | Legionella pneumophila | Q5ZWI4 | WP_010946835.1 | 24064423 |
SS01422 | lpg1083 | lpg1083 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZWK2 | WP_010946818.1 | 24064423 |
SS01423 | lpg0969 | Dot/Icm T4SS effector RavK (NCBI) | Legionella pneumophila | Q5ZWW5 | WP_010946704.1 | 24064423 |
SS01424 | lpg0968 | Dot/Icm T4SS effector v-ATPase inhibitor SidK (NCBI) | Legionella pneumophila | Q5ZWW6 | WP_010946703.1 | 24064423 |
SS01425 | lpg0967 | lpg0967 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZWW7 | WP_010946702.1 | 24064423 |
SS01426 | lpg0963 | lpg0963 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZWX1 | WP_010946698.1 | 24064423 |
SS01427 | legL1 | Dot/Icm T4SS effector LegL1 (NCBI) | Legionella pneumophila | Q5ZWY8 | WP_010946680.1 | 24064423 |
SS01428 | lpg0944 | Dot/Icm T4SS effector RavJ (NCBI) | Legionella pneumophila | Q5ZWY9 | WP_010946679.1 | 24064423 |
SS01429 | lpg0940 | LidA (UniProt) | Legionella pneumophila | Q5ZWZ3 | WP_010946675.1 | 24064423 |
SS01430 | lpg0926 | Dot/Icm T4SS effector RavI (NCBI) | Legionella pneumophila | Q5ZX07 | WP_010946661.1 | 24064423 |
SS01431 | lpg0921 | hypothetical protein lpg0921 (NCBI) | Legionella pneumophila | Q5ZX12 | AAU27008.1 | 24064423 |
SS01432 | lpg0898 | Dot/Icm T4SS effector Ceg18 (NCBI) | Legionella pneumophila | Q5ZX35 | WP_010946633.1 | 24064423 |
SS01433 | lpg0796 | lpg0796 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZXD5 | WP_010946533.1 | 24064423 |
SS01434 | lpg0733 | Dot/Icm T4SS effector RavH (NCBI) | Legionella pneumophila | Q5ZXJ8 | WP_010946470.1 | 24064423 |
SS01435 | lem3 | Phosphocholine hydrolase Lem3 (NCBI) | Legionella pneumophila | Q5ZXN5 | Q5ZXN5.1 | 24064423 |
SS01436 | ankX | Phosphocholine transferase AnkX (UniProt) | Legionella pneumophila | Q5ZXN6 | WP_010946432.1 | 24064423 |
SS01437 | lpg0645 | Uncharacterized protein (UniProt) | Legionella pneumophila | Q5ZXT6 | 24064423 | |
SS01438 | lpg0642 | Dot/Icm T4SS effector WipB (NCBI) | Legionella pneumophila | Q5ZXT9 | WP_010946379.1 | 24064423 |
SS01439 | lpg0634 | lpg0634 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZXU7 | WP_010946371.1 | 24064423 |
SS01440 | sidA | SidA (UniProt) | Legionella pneumophila | Q5ZXW0 | CAH11823.1 | 24064423 |
SS01441 | lpg0519 | Dot/Icm T4SS effector Ceg17 (NCBI) | Legionella pneumophila | Q5ZY53 | WP_010946267.1 | 24064423 |
SS01442 | lpg0518 | lpg0518 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZY54 | WP_010946266.1 | 24064423 |
SS01443 | legA12 | Dot/Icm T4SS effector AnkC/LegA12 (NCBI) | Legionella pneumophila | Q5ZY89 | WP_010946231.1 | 24064423 |
SS01444 | lpg0439 | Dot/Icm T4SS effector Ceg15 (NCBI) | Legionella pneumophila | Q5ZYD3 | WP_010946188.1 | 24064423 |
SS01445 | lpg0437 | Dot/Icm T4SS effector Ceg14/sidL (NCBI) | Legionella pneumophila | Q5ZYD5 | WP_010946186.1 | 24064423 |
SS01446 | legA11 | Dot/Icm T4SS effector AnkJ/LegA11 (NCBI) | Legionella pneumophila | Q5ZYD6 | WP_010946185.1 | 24064423 |
SS01447 | lpg0405 | lpg0405 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZYG7 | WP_010946154.1 | 24064423 |
SS01448 | legA7 | Dot/Icm T4SS effector AnkG/AnkZ/LegA7 (NCBI) | Legionella pneumophila | Q5ZYG9 | WP_010946152.1 | 24064423 |
SS01449 | legA9 | Dot/Icm T4SS effector AnkY/LegA9 (NCBI) | Legionella pneumophila | Q5ZYH0 | WP_010946151.1 | 24064423 |
SS01450 | lpg0401 | Dot/Icm T4SS effector LegA7 (NCBI) | Legionella pneumophila | Q5ZYH1 | WP_010946150.1 | 24064423 |
SS01451 | lpg0393 | Lpg0393 family guanine-nucleotide exchange effector (NCBI) | Legionella pneumophila | Q5ZYH9 | WP_010946142.1 | 24064423 |
SS01452 | vipA | VipA (UniProt) | Legionella pneumophila | Q5ZYI2 | WP_010946139.1 | 24064423 |
SS01453 | sdhA | SdhA, GRIP coiled-coil protein GCC185 (UniProt) | Legionella pneumophila | Q5ZYJ6 | WP_010946125.1 | 24064423 |
SS01454 | lpg0375 | lpg0375 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZYJ7 | WP_010946124.1 | 24064423 |
SS01455 | lpg0365 | lpg0365 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZYK7 | WP_010946114.1 | 24064423 |
SS01456 | lpg0364 | Lpg0364 family Dot/Icm type IV secretion system effector (NCBI) | Legionella pneumophila | Q5ZYK8 | WP_010946113.1 | 24064423 |
SS01457 | lpg0294 | lpg0294 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZYR7 | WP_010946055.1 | 24064423 |
SS01458 | lpg0285 | Dot/Icm T4SS effector Lem2 (NCBI) | Legionella pneumophila | Q5ZYS6 | WP_010946046.1 | 24064423 |
SS01459 | lpg0284 | Dot/Icm T4SS effector Ceg10 (NCBI) | Legionella pneumophila | Q5ZYS7 | WP_010946045.1 | 24064423 |
SS01460 | legG2 | Dot/Icm T4SS effector LegG2 (NCBI) | Legionella pneumophila | Q5ZYT5 | WP_010946037.1 | 24064423 |
SS01461 | lpg0275 | Dot/Icm T4SS effector SdbA (NCBI) | Legionella pneumophila | Q5ZYT6 | WP_010946036.1 | 24064423 |
SS01462 | lpg0260 | lpg0260 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZYV1 | WP_010946021.1 | 24064423 |
SS01463 | lpg0254 | hypothetical protein lpg0254 (NCBI) | Legionella pneumophila | Q5ZYV7 | AAU26361.1 | 24064423 |
SS01464 | lpg0246 | Dot/Icm T4SS effector Ceg9 (NCBI) | Legionella pneumophila | Q5ZYW5 | WP_010946007.1 | 24064423 |
SS01465 | recN | Dot/Icm T4SS effector Ceg8 (NCBI) | Legionella pneumophila | Q5ZYX1 | WP_010946001.1 | 24064423 |
SS01466 | lpg0210 | Dot/Icm T4SS effector RavG (NCBI) | Legionella pneumophila | Q5ZZ01 | WP_010945971.1 | 24064423 |
SS01467 | pkn5 | Serine/threonine-protein kinase (UniProt, NCBI) | Legionella pneumophila | Q5ZZ03 | WP_010945969.1 | 24064423 |
SS01468 | lpg0195 | Dot/Icm T4SS effector RavE (NCBI) | Legionella pneumophila | Q5ZZ16 | WP_010945956.1 | 24064423 |
SS01469 | lpg0191 | Dot/Icm T4SS effector Ceg5 (NCBI) | Legionella pneumophila | Q5ZZ20 | WP_010945952.1 | 24064423 |
SS01470 | lpg0181 | lpg0181 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZZ30 | WP_010945942.1 | 24064423 |
SS01471 | lpg0172 | lpg0172 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZZ39 | WP_010945933.1 | 24064423 |
SS01472 | legU1 | Dot/Icm type IV secretion system effector (NCBI) | Legionella pneumophila | Q5ZZ40 | WP_010945932.1 | 24064423 |
SS01473 | lpg0160 | hypothetical protein lpg0160 (NCBI) | Legionella pneumophila | Q5ZZ51 | AAU26267.1 | 24064423 |
SS01474 | lpg0140 | hypothetical protein lpg0140 (NCBI) | Legionella pneumophila | Q5ZZ71 | AAU26247.1 | 24064423 |
SS01475 | sdhB | Dot/Icm T4SS effector SdhB (NCBI) | Legionella pneumophila | Q5ZZ76 | WP_080447065.1 | 24064423 |
SS01476 | lpg0130 | hypothetical protein lpg0130 (NCBI) | Legionella pneumophila | Q5ZZ81 | AAU26237.1 | 24064423 |
SS01477 | lpg0126 | Dot/Icm T4SS effector CegC2 (NCBI) | Legionella pneumophila | Q5ZZ85 | WP_010945887.1 | 24064423 |
SS01478 | lpg0107 | DUF155 domain-containing protein (UniProt) | Legionella pneumophila | Q5ZZA4 | 24064423 | |
SS01479 | vipF | Dot/Icm T4SS effector N-acetyltransferase VipF (NCBI) | Legionella pneumophila | Q5ZZA8 | WP_010945864.1 | 24064423 |
SS01480 | lpg0096 | Dot/Icm T4SS effector phosphotyrosine phosphatase Ceg4 (NCBI) | Legionella pneumophila | Q5ZZB5 | WP_010945857.1 | 24064423 |
SS01481 | lpg0090 | Dot/Icm T4SS effector Lem1 (NCBI) | Legionella pneumophila | Q5ZZC1 | WP_010945851.1 | 24064423 |
SS01482 | lpg0081 | lpg0081 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | Q5ZZD0 | WP_010945842.1 | 24064423 |
SS01483 | lpg0080 | Dot/Icm T4SS effector Ceg3 (NCBI) | Legionella pneumophila | Q5ZZD1 | WP_010945841.1 | 24064423 |
SS01484 | lpg0059 | hypothetical protein lpg0059 (NCBI) | Legionella pneumophila | Q5ZZF1 | AAU26167.1 | 24064423 |
SS01485 | lpg0046 | hypothetical protein lpg0046 (NCBI) | Legionella pneumophila | Q5ZZG4 | AAU26154.1 | 24064423 |
SS01486 | lpg0038 | Dot/Icm T4SS effector AnkQ/LegA10 (NCBI) | Legionella pneumophila | Q5ZZH2 | WP_010945800.1 | 24064423 |
SS01487 | lpg0030 | hypothetical protein lpg0030 (NCBI) | Legionella pneumophila | Q5ZZI0 | AAU26138.1 | 24064423 |
SS01488 | lpg0021 | hypothetical protein LP6_0022 (NCBI) | Legionella pneumophila | Q5ZZI9 | AGN12948.1 | 24064423 |
SS01489 | lpg0012 | Dot/Icm T4SS effector CegC1 (NCBI) | Legionella pneumophila | Q5ZZJ8 | WP_010945774.1 | 24064423 |
SS01490 | lpg0008 | hypothetical protein lpg0008 (NCBI) | Legionella pneumophila | Q5ZZK2 | AAU26116.1 | 24064423 |
SS01491 | riorf55 | hypothetical protein pRi1724_p056 (NCBI) | Agrobacterium tumefaciens | NP_066636.1 | 23193298 | |
SS01492 | riorf146 | hypothetical protein pRi1724_p147 (NCBI) | Agrobacterium tumefaciens | NP_066727.1 | 23193298 | |
SS01493 | riorf168 | hypothetical protein pRi1724_p169 (NCBI) | Agrobacterium tumefaciens | NP_066749.1 | 23193298 | |
SS01494 | riorf171 | hypothetical protein pRi1724_p172 (NCBI) | Agrobacterium tumefaciens | NP_066752.1 | 23193298 | |
SS01495 | riorf173 | hypothetical protein pRi1724_p001 (NCBI) | Agrobacterium tumefaciens | NP_066581.1 | 23193298 | |
SS01496 | virD2 | hypothetical protein pTi_142 (NCBI) | Agrobacterium tumefaciens | NP_059814.1 | 23193298 | |
SS01497 | virD5 | hypothetical protein pTi_145 (NCBI) | Agrobacterium tumefaciens | NP_059817.1 | 23193298 | |
SS01498 | virE2 | hypothetical protein pTi_147 (NCBI) | Agrobacterium tumefaciens | NP_059819.1 | 23193298 | |
SS01499 | virE3 | hypothetical protein pTi_148 (NCBI) | Agrobacterium tumefaciens | NP_059820.1 | 23193298 | |
SS01500 | virF | hypothetical protein pTi_152 (NCBI) | Agrobacterium tumefaciens | NP_059824.1 | 23193298 | |
SS01501 | cagA | type IV secretion system oncogenic effector CagA (NCBI) | Helicobacter pylori | WP_000180410.1 | 23193298 | |
SS01502 | cagA | type IV secretion system oncogenic effector CagA (NCBI) | Helicobacter pylori | WP_000180747.1 | 23193298 | |
SS01503 | T-DNA border endonuclease VirD2 (NCBI) | Agrobacterium tumefaciens | WP_010974919.1 | 23193298 | ||
SS01504 | virA/G regulated protein (NCBI) | Agrobacterium tumefaciens | WP_010974921.1 | 23193298 | ||
SS01505 | type IV secretion system single-stranded DNA binding protein VirE2 (NCBI) | Agrobacterium tumefaciens | WP_010974922.1 | 23193298 | ||
SS01506 | virA/G regulated protein (NCBI) | Agrobacterium tumefaciens | WP_010974923.1 | 23193298 | ||
SS01507 | hypothetical protein (NCBI) | Agrobacterium tumefaciens | WP_010891511.1 | 23193298 | ||
SS01508 | gamma carbonic anhydrase family protein (NCBI) | Brucella melitensis | WP_002964382.1 | 23193298 | ||
SS01509 | low-affinity inorganic phosphate transporter (NCBI) | Coxiella burnetii | NP_819070.1 | 23193298 | ||
SS01510 | hypothetical protein CBU_0041 (NCBI) | Coxiella burnetii | NP_819096.1 | 23193298 | ||
SS01511 | ankyrin repeat-containing protein (NCBI) | Coxiella burnetii | NP_819125.1 | 23193298 | ||
SS01512 | serine/threonine kinase (NCBI) | Coxiella burnetii | NP_819221.1 | 23193298 | ||
SS01513 | hypothetical protein CBU_0295 (NCBI) | Coxiella burnetii | NP_819338.1 | 23193298 | ||
SS01514 | hypothetical protein CBU_0410 (NCBI) | Coxiella burnetii | NP_819448.1 | 23193298 | ||
SS01515 | hypothetical protein CBU_0425 (NCBI) | Coxiella burnetii | NP_819463.1 | 23193298 | ||
SS01516 | ankyrin repeat-containing protein (NCBI) | Coxiella burnetii | NP_819484.1 | 23193298 | ||
SS01517 | hypothetical protein CBU_0635 (NCBI) | Coxiella burnetii | NP_819665.1 | 23193298 | ||
SS01518 | ankyrin repeat-containing protein (NCBI) | Coxiella burnetii | NP_819802.1 | 23193298 | ||
SS01519 | hypothetical protein CBU_0794 (NCBI) | Coxiella burnetii | NP_819814.1 | 23193298 | ||
SS01520 | ribosomal-protein-S18-alanine acetyltransferase (NCBI) | Coxiella burnetii | NP_819821.1 | 23193298 | ||
SS01521 | hypothetical protein CBU_0881 (NCBI) | Coxiella burnetii | NP_819899.1 | 23193298 | ||
SS01522 | ankyrin repeat-containing protein (NCBI) | Coxiella burnetii | NP_820208.1 | 23193298 | ||
SS01523 | membrane-spanning protein (NCBI) | Coxiella burnetii | NP_820212.1 | 23193298 | ||
SS01524 | 17 kDa common-antigen (NCBI) | Coxiella burnetii | NP_820409.1 | 23193298 | ||
SS01526 | hypothetical protein CBU_1460 (NCBI) | Coxiella burnetii | NP_820443.1 | 23193298 | ||
SS01527 | hypothetical protein CBU_1543 (NCBI) | Coxiella burnetii | NP_820526.1 | 23193298 | ||
SS01528 | membrane-spanning protein (NCBI) | Coxiella burnetii | NP_820539.1 | 23193298 | ||
SS01529 | hypothetical protein CBU_1569 (NCBI) | Coxiella burnetii | NP_820552.1 | 23193298 | ||
SS01530 | hypothetical protein CBU_1636 (NCBI) | Coxiella burnetii | NP_820618.1 | 23193298 | ||
SS01531 | hypothetical protein CBU_1751 (NCBI) | Coxiella burnetii | NP_820731.1 | 23193298 | ||
SS01532 | alpha/beta hydrolase (NCBI) | Coxiella burnetii | NP_820749.1 | 23193298 | ||
SS01533 | hypothetical protein CBU_1823 (NCBI) | Coxiella burnetii | NP_820802.1 | 23193298 | ||
SS01534 | hypothetical protein CBU_1825 (NCBI) | Coxiella burnetii | NP_820804.1 | 23193298 | ||
SS01535 | hypothetical protein CBU_2052 (NCBI) | Coxiella burnetii | NP_821023.1 | 23193298 | ||
SS01536 | Fic family protein (NCBI) | Coxiella burnetii | NP_821048.1 | 23193298 | ||
SS01537 | ptxA | pertussis toxin ADP-ribosyltransferase subunit S1 (NCBI) | Bordetella pertussis | WP_010931648.1 | 23193298 | |
SS01538 | ptxB | pertussis toxin binding subunit S2 (NCBI) | Bordetella pertussis | WP_010931649.1 | 23193298 | |
SS01539 | ptxD | pertussis toxin subunit 4 (NCBI) | Bordetella pertussis | WP_010929491.1 | 23193298 | |
SS01541 | ptxC | ptxC gene product (NCBI) | Bordetella pertussis | WP_010931651.1 | 23193298 | |
SS01542 | bepA | T4SS effector adenylyltransferase BepA (NCBI) | Bartonella henselae | WP_011181138.1 | 23193298 | |
SS01543 | bepB | T4SS effector adenylyltransferase BepB (NCBI) | Bartonella henselae | WP_011181140.1 | 23193298 | |
SS01544 | bepC | T4SS effector adenylyltransferase BepC (NCBI) | Bartonella henselae | WP_011181141.1 | 23193298 | |
SS01545 | bepD | T4SS effector BepD (NCBI) | Bartonella henselae | WP_011181142.1 | 23193298 | |
SS01546 | bepE | T4SS effector BepE (NCBI) | Bartonella henselae | WP_011181143.1 | 23193298 | |
SS01547 | bepF | T4SS effector BepF (NCBI) | Bartonella henselae | WP_011181144.1 | 23193298 | |
SS01548 | bepG | T4SS effector BepG (NCBI) | Bartonella henselae | WP_011181145.1 | 23193298 | |
SS01549 | cegC1 | Dot/Icm T4SS effector CegC1 (NCBI) | Legionella pneumophila | WP_010945774.1 | 23193298 | |
SS01550 | ankQ | Dot/Icm T4SS effector AnkQ/LegA10 (NCBI) | Legionella pneumophila | WP_010945800.1 | 23193298 | |
SS01551 | lpg0045 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010945807.1 | 23193298 | ||
SS01552 | ceg3 | Dot/Icm T4SS effector Ceg3 (NCBI) | Legionella pneumophila | WP_010945841.1 | 23193298 | |
SS01553 | lpg0081 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010945842.1 | 23193298 | ||
SS01554 | lem1 | Dot/Icm T4SS effector Lem1 (NCBI) | Legionella pneumophila | WP_010945851.1 | 23193298 | |
SS01555 | ceg4 | Dot/Icm T4SS effector phosphotyrosine phosphatase Ceg4 (NCBI) | Legionella pneumophila | WP_010945857.1 | 23193298 | |
SS01556 | vipF | Dot/Icm T4SS effector N-acetyltransferase VipF (NCBI) | Legionella pneumophila | WP_010945864.1 | 23193298 | |
SS01557 | cegC2 | Dot/Icm T4SS effector CegC2 (NCBI) | Legionella pneumophila | WP_010945887.1 | 23193298 | |
SS01558 | sdhB | Dot/Icm T4SS effector SdhB (NCBI) | Legionella pneumophila | WP_010945896.1 | 23193298 | |
SS01559 | ceg5 | Dot/Icm T4SS effector Ceg5 (NCBI) | Legionella pneumophila | WP_010945952.1 | 23193298 | |
SS01560 | ceg7 | Dot/Icm T4SS effector Ceg7 (NCBI) | Legionella pneumophila | WP_010945988.1 | 23193298 | |
SS01561 | sidE | T4SS effector NAD-dependent ubiquitin ligase SidE (NCBI) | Legionella pneumophila | WP_010945995.1 | 23193298 | |
SS01562 | ceg8 | Dot/Icm T4SS effector Ceg8 (NCBI) | Legionella pneumophila | WP_010946001.1 | 23193298 | |
SS01563 | sdbA | Dot/Icm T4SS effector SdbA (NCBI) | Legionella pneumophila | WP_010946036.1 | 23193298 | |
SS01564 | ceg10 | Dot/Icm T4SS effector Ceg10 (NCBI) | Legionella pneumophila | WP_010946045.1 | 23193298 | |
SS01565 | lem2 | Dot/Icm T4SS effector Lem2 (NCBI) | Legionella pneumophila | WP_010946046.1 | 23193298 | |
SS01566 | lpg0294 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010946055.1 | 23193298 | ||
SS01567 | lpg0365 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010946114.1 | 23193298 | ||
SS01568 | vipA | Dot/Icm T4SS effector VipA (NCBI) | Legionella pneumophila | WP_010946139.1 | 23193298 | |
SS01569 | ankJ | Dot/Icm T4SS effector AnkJ/LegA11 (NCBI) | Legionella pneumophila | WP_010946185.1 | 23193298 | |
SS01570 | ceg14 | Dot/Icm T4SS effector Ceg14/sidL (NCBI) | Legionella pneumophila | WP_010946186.1 | 23193298 | |
SS01571 | lpg0518 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010946266.1 | 23193298 | ||
SS01572 | ceg17 | unnamed protein product (NCBI) | Legionella pneumophila | WP_010946267.1 | 23193298 | |
SS01573 | sidA | T4SS effector SidA (NCBI) | Legionella pneumophila | WP_010946358.1 | 23193298 | |
SS01574 | lpg0634 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010946371.1 | 23193298 | ||
SS01575 | wipB | Dot/Icm T4SS effector WipB (NCBI) | Legionella pneumophila | WP_010946379.1 | 23193298 | |
SS01576 | ankN | Dot/Icm T4SS effector AnkX (NCBI) | Legionella pneumophila | WP_010946432.1 | 23193298 | |
SS01577 | lem3 | T4SS effector phosphocholine hydrolase Lem3 (NCBI) | Legionella pneumophila | WP_010946433.1 | 23193298 | |
SS01578 | ceg18 | Dot/Icm T4SS effector Ceg18 (NCBI) | Legionella pneumophila | WP_010946633.1 | 23193298 | |
SS01579 | lidA | Dot/Icm T4SS effector LidA (NCBI) | Legionella pneumophila | WP_010946675.1 | 23193298 | |
SS01580 | lpg0963 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010946698.1 | 23193298 | ||
SS01581 | sidK | Dot/Icm T4SS effector v-ATPase inhibitor SidK (NCBI) | Legionella pneumophila | WP_010946703.1 | 23193298 | |
SS01582 | lem4 | Dot/Icm T4SS effector Lem4/SmdA (NCBI) | Legionella pneumophila | WP_010946835.1 | 23193298 | |
SS01583 | lem6 | Dot/Icm T4SS effector Lem6 (NCBI) | Legionella pneumophila | WP_010946854.1 | 23193298 | |
SS01584 | ceg19 | Dot/Icm T4SS effector Ceg19 (NCBI) | Legionella pneumophila | WP_010946855.1 | 23193298 | |
SS01585 | cegC3 | Dot/Icm T4SS effector CegC3 (NCBI) | Legionella pneumophila | WP_010946878.1 | 23193298 | |
SS01586 | lem7 | Dot/Icm T4SS effector Lem7 (NCBI) | Legionella pneumophila | WP_010946879.1 | 23193298 | |
SS01587 | lpg1148 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010946882.1 | 23193298 | ||
SS01588 | lpg1158 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010946892.1 | 23193298 | ||
SS01589 | vpdB | Dot/Icm T4SS effector VpdB (NCBI) | Legionella pneumophila | WP_010946959.1 | 23193298 | |
SS01590 | lpg1273 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947004.1 | 23193298 | ||
SS01591 | lem8 | Dot/Icm T4SS effector Lem8 (NCBI) | Legionella pneumophila | WP_010947021.1 | 23193298 | |
SS01592 | sidG | Dot/Icm T4SS effector SidG (NCBI) | Legionella pneumophila | WP_010947085.1 | 23193298 | |
SS01593 | vpdC | Dot/Icm T4SS effector VpdC (NCBI) | Legionella pneumophila | WP_010947155.1 | 23193298 | |
SS01594 | legK1 | Dot/Icm type IV secretion system effector kinase LegK1 (NCBI) | Legionella pneumophila | WP_010947212.1 | 23193298 | |
SS01595 | lgt3 | Dot/Icm type IV secretion system effector Lgt3/LegC5 (NCBI) | Legionella pneumophila | WP_010947217.1 | 23193298 | |
SS01596 | lem9 | Dot/Icm T4SS effector Lem9 (NCBI) | Legionella pneumophila | WP_010947220.1 | 23193298 | |
SS01597 | lem10 | Dot/Icm T4SS effector Lem10 (NCBI) | Legionella pneumophila | WP_010947225.1 | 23193298 | |
SS01598 | legC6 | Dot/Icm T4SS effector LegC6 (NCBI) | Legionella pneumophila | WP_010947317.1 | 23193298 | |
SS01599 | lem11 | Dot/Icm T4SS effector Lem11 (NCBI) | Legionella pneumophila | WP_010947327.1 | 23193298 | |
SS01600 | ceg23 | Dot/Icm T4SS effector Ceg23 (NCBI) | Legionella pneumophila | WP_010947348.1 | 23193298 | |
SS01601 | lem12 | Dot/Icm T4SS effector Lem12 (NCBI) | Legionella pneumophila | WP_010947352.1 | 23193298 | |
SS01602 | sidB | Dot/Icm T4SS effector SidB (NCBI) | Legionella pneumophila | WP_010947369.1 | 23193298 | |
SS01603 | legL3 | Dot/Icm T4SS effector LegL3 (NCBI) | Legionella pneumophila | WP_010947387.1 | 23193298 | |
SS01604 | lpg1689 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947416.1 | 23193298 | ||
SS01605 | ppeB | Dot/Icm T4SS effector PpeB (NCBI) | Legionella pneumophila | WP_010947429.1 | 23193298 | |
SS01606 | lpg1717 family Dot/Icm T4SS effector(NCBI) | Legionella pneumophila | WP_010947444.1 | 23193298 | ||
SS01607 | lpg1751 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947477.1 | 23193298 | ||
SS01608 | lem14 | Dot/Icm T4SS effector Lem14 (NCBI) | Legionella pneumophila | WP_010947577.1 | 23193298 | |
SS01609 | legC2 | Dot/Icm T4SS effector LegC2/YlfB (NCBI) | Legionella pneumophila | WP_010947601.1 | 23193298 | |
SS01610 | legLC8 | Dot/Icm T4SS effector LegLC8 (NCBI) | Legionella pneumophila | WP_010947607.1 | 23193298 | |
SS01611 | lem15 | Dot/Icm T4SS effector Lem15 (NCBI) | Legionella pneumophila | WP_010947649.1 | 23193298 | |
SS01612 | lem16 | Dot/Icm T4SS effector Lem16 (NCBI) | Legionella pneumophila | WP_010947663.1 | 23193298 | |
SS01613 | legLC4 | Dot/Icm T4SS effector LegLC4 (NCBI) | Legionella pneumophila | WP_010947664.1 | 23193298 | |
SS01614 | lem17 | Dot/Icm T4SS effector Lem17 (NCBI) | Legionella pneumophila | WP_010947665.1 | 23193298 | |
SS01615 | ralF | T4SS guanine nucleotide exchange effector RalF (NCBI) | Legionella pneumophila | WP_010947666.1 | 23193298 | |
SS01616 | legL5 | Dot/Icm T4SS effector LegL5 (NCBI) | Legionella pneumophila | WP_010947674.1 | 23193298 | |
SS01617 | lirA | Dot/Icm T4SS effector LirA (NCBI) | Legionella pneumophila | WP_010947676.1 | 23193298 | |
SS01618 | peptidylprolyl isomerase (NCBI) | Legionella pneumophila | WP_010947678.1 | 23193298 | ||
SS01619 | pieA | Dot/Icm T4SS effector PieA/LirC (NCBI) | Legionella pneumophila | WP_010947679.1 | 23193298 | |
SS01620 | pieB | Dot/Icm T4SS effector PieB/LirD (NCBI) | Legionella pneumophila | WP_010947680.1 | 23193298 | |
SS01621 | pieC | Dot/Icm T4SS effector PieC/LirE (NCBI) | Legionella pneumophila | WP_010947681.1 | 23193298 | |
SS01622 | pieD | Dot/Icm T4SS effector PieD/LirF (NCBI) | Legionella pneumophila | WP_010947682.1 | 23193298 | |
SS01623 | pieE | Dot/Icm T4SS effector PieE (NCBI) | Legionella pneumophila | WP_010947685.1 | 23193298 | |
SS01624 | sdeC | Dot/Icm T4SS effector SdeC/LaiC (NCBI) | Legionella pneumophila | WP_010947864.1 | 23193298 | |
SS01626 | sidJ | T4SS meta-effector polyglutamylase SidJ (NCBI) | Legionella pneumophila | WP_010947866.1 | 23193298 | |
SS01628 | sdeA | T4SS effector NAD-dependent ubiquitin ligase SdeA (NCBI) | Legionella pneumophila | WP_010947868.1 | 23193298 | |
SS01629 | lem19 | Dot/Icm T4SS effector Lem19 (NCBI) | Legionella pneumophila | WP_010947877.1 | 23193298 | |
SS01630 | legS2 | Dot/Icm T4SS effector sphingosine 1-phosphate lyase LegS2 (NCBI) | Legionella pneumophila | WP_010947885.1 | 23193298 | |
SS01631 | cegC4 | Dot/Icm T4SS effector CegC4 (NCBI) | Legionella pneumophila | WP_010947909.1 | 23193298 | |
SS01632 | lem20 | Dot/Icm T4SS effector Lem20 (NCBI) | Legionella pneumophila | WP_010947925.1 | 23193298 | |
SS01633 | lem21 | Dot/Icm T4SS effector Lem21 (NCBI) | Legionella pneumophila | WP_010947957.1 | 23193298 | |
SS01634 | legC7 | Dot/Icm T4SS effector LegC7/YlfA (NCBI) | Legionella pneumophila | WP_010948004.1 | 23193298 | |
SS01635 | lpg2327 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948033.1 | 23193298 | ||
SS01636 | lem22 | Dot/Icm T4SS effector Lem22 (NCBI) | Legionella pneumophila | WP_010948034.1 | 23193298 | |
SS01637 | sdbC | Dot/Icm T4SS effector SdbC (NCBI) | Legionella pneumophila | WP_010948095.1 | 23193298 | |
SS01638 | legL7 | Dot/Icm T4SS effector LegL7 (NCBI) | Legionella pneumophila | WP_010948104.1 | 23193298 | |
SS01639 | lem23 | Dot/Icm T4SS effector Lem23 (NCBI) | Legionella pneumophila | WP_010948110.1 | 23193298 | |
SS01640 | lpg2407 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948111.1 | 23193298 | ||
SS01641 | ceg29 | Dot/Icm type IV secretion system effector Ceg29 (NCBI) | Legionella pneumophila | WP_010948113.1 | 23193298 | |
SS01642 | vpdA | Dot/Icm type IV secretion system effector VdpA (NCBI) | Legionella pneumophila | WP_010948114.1 | 23193298 | |
SS01643 | lem24 | Dot/Icm T4SS effector Lem24 (NCBI) | Legionella pneumophila | WP_010948115.1 | 23193298 | |
SS01644 | lem25 | Dot/Icm T4SS effector Lem25 (NCBI) | Legionella pneumophila | WP_010948125.1 | 23193298 | |
SS01645 | ceg30 | Dot/Icm T4SS effector Ceg30 (NCBI) | Legionella pneumophila | WP_010948136.1 | 23193298 | |
SS01646 | multifunctional virulence effector protein DrrA (NCBI) | Legionella pneumophila | WP_010948166.1 | 23193298 | ||
SS01647 | sidD | T4SS effector deAMPylase SidD (NCBI) | Legionella pneumophila | WP_010948167.1 | 23193298 | |
SS01648 | sdbB | Dot/Icm T4SS effector SdbB (NCBI) | Legionella pneumophila | WP_010948184.1 | 23193298 | |
SS01649 | lepB | Dot/Icm T4SS GTPase-activating effector LepB (NCBI) | Legionella pneumophila | WP_010948192.1 | 23193298 | |
SS01650 | ceg32 | Dot/Icm T4SS effector Ceg32/SidI (NCBI) | Legionella pneumophila | WP_010948206.1 | 23193298 | |
SS01651 | sdjA | Dot/Icm T4SS effector SdjA (NCBI) | Legionella pneumophila | WP_010948210.1 | 23193298 | |
SS01652 | dupB | Dot/Icm T4SS effector deubiquitinase DupB/LaiF (NCBI) | Legionella pneumophila | WP_010948211.1 | 23193298 | |
SS01653 | sdcA | Dot/Icm T4SS effector SdcA (NCBI) | Legionella pneumophila | WP_010948212.1 | 23193298 | |
SS01654 | sidC | Dot/Icm T4SS effector SidC (NCBI) | Legionella pneumophila | WP_010948213.1 | 23193298 | |
SS01655 | lem26 | Dot/Icm T4SS effector Lem26 (NCBI) | Legionella pneumophila | WP_010948225.1 | 23193298 | |
SS01656 | lpg2527 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948229.1 | 23193298 | ||
SS01657 | lem27 | Dot/Icm T4SS effector Lem27 (NCBI) | Legionella pneumophila | WP_010948231.1 | 23193298 | |
SS01658 | sidF | Dot/Icm T4SS effector SidF (NCBI) | Legionella pneumophila | WP_010948284.1 | 23193298 | |
SS01659 | ceg33 | Dot/Icm T4SS effector Ceg33 (NCBI) | Legionella pneumophila | WP_010948291.1 | 23193298 | |
SS01660 | lem28 | Dot/Icm T4SS effector Lem28 (NCBI) | Legionella pneumophila | WP_010948303.1 | 23193298 | |
SS01661 | wipA | Dot/Icm T4SS effector WipA (NCBI) | Legionella pneumophila | WP_010948417.1 | 23193298 | |
SS01662 | lpg2744 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948442.1 | 23193298 | ||
SS01663 | lepA | Dot/Icm type IV secretion system effector LepA (NCBI) | Legionella pneumophila | WP_010948481.1 | 23193298 | |
SS01664 | lem29 | Dot/Icm T4SS effector Lem29 (NCBI) | Legionella pneumophila | WP_010948491.1 | 23193298 | |
SS01665 | ceg34 | Dot/Icm T4SS effector Ceg34 (NCBI) | Legionella pneumophila | WP_010948513.1 | 23193298 | |
SS01666 | sidH | Dot/Icm T4SS effector SidH (NCBI) | Legionella pneumophila | WP_010948516.1 | 23193298 | |
SS01667 | E3 ubiquitin--protein ligase (NCBI) | Legionella pneumophila | WP_010948517.1 | 23193298 | ||
SS01668 | vipD | Dot/Icm type IV secretion system effector VipD (NCBI) | Legionella pneumophila | WP_010948518.1 | 23193298 | |
SS01669 | lgt2 | Dot/Icm type IV secretion system effector glucosyltransferase Lgt2/LegC8 (NCBI) | Legionella pneumophila | WP_010948548.1 | 23193298 | |
SS01670 | lpg2874 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948560.1 | 23193298 | ||
SS01671 | legK1 | Dot/Icm type IV secretion system effector kinase LegK1 (NCBI) | Legionella pneumophila | WP_011215583.1 | 23193298 | |
SS01672 | protein kinase (NCBI) | Legionella pneumophila | WP_011216046.1 | 23193298 | ||
SS01673 | legK3 | Dot/Icm T4SS effector LegK3 (NCBI) | Legionella pneumophila | WP_011216437.1 | 23193298 | |
SS01675 | hypothetical protein (NCBI) | Anaplasma marginale | WP_011114156.1 | 23193298 | ||
SS01676 | hypothetical protein (NCBI) | Anaplasma marginale | WP_011114288.1 | 23193298 | ||
SS01677 | ankyrin repeat domain-containing protein (NCBI) | Anaplasma marginale | WP_011114402.1 | 23193298 | ||
SS01680 | FliO/MopB (NCBI) | Brucella melitensis | WP_002966824.1 | 23193298 | ||
SS01683 | PepSY domain-containing protein (NCBI) | Brucella melitensis | WP_002969602.1 | 23193298 | ||
SS01684 | cyclic nucleotide-binding domain-containing protein (NCBI) | Brucella melitensis | WP_002965067.1 | 23193298 | ||
SS01685 | hypothetical protein (NCBI) | Brucella melitensis | WP_002966455.1 | 23193298 | ||
SS01687 | ankA | T4SS effector DNA-binding phosphoprotein AnkA (NCBI) | Anaplasma phagocytophilum | WP_011450840.1 | 23193298 | |
SS01688 | hypothetical protein (NCBI) | Ehrlichia chaffeensis | WP_011452831.1 | 23193298 | ||
SS01689 | cagA | type IV secretion system oncogenic effector CagA (NCBI) | Helicobacter pylori | WP_000180786.1 | 23193298 | |
SS01690 | ankG | ankyrin repeat domain-containing T4SS effector AnkG (NCBI) | Coxiella burnetii | WP_011996770.1 | 23193298 | |
SS01692 | ankM | Dot/Icm T4SS effector AnkM (NCBI) | Coxiella burnetii | WP_011996490.1 | 23193298 | |
SS01695 | cagA | type IV secretion system oncogenic effector CagA (NCBI) | Helicobacter pylori | WP_001262964.1 | 23193298 | |
SS01696 | rcorf28 (plasmid) (NCBI) | Agrobacterium tumefaciens | YP_001961003.1 | 23193298 | ||
SS01697 | rcorf114 (plasmid) (NCBI) | Agrobacterium tumefaciens | YP_001961089.1 | 23193298 | ||
SS01698 | rcorf138 (plasmid) (NCBI) | Agrobacterium tumefaciens | YP_001961113.1 | 23193298 | ||
SS01699 | rcorf141 (plasmid) (NCBI) | Agrobacterium tumefaciens | YP_001961116.1 | 23193298 | ||
SS01700 | rcorf143 (plasmid) (NCBI) | Agrobacterium tumefaciens | YP_001961118.1 | 23193298 | ||
SS01701 | cagA | type IV secretion system oncogenic effector CagA (NCBI) | Helicobacter pylori | WP_000180783.1 | 23193298 | |
SS01702 | ankyrin repeat domain-containing protein (NCBI) | Coxiella burnetii | WP_011996917.1 | 23193298 | ||
SS01703 | ankP | ankyrin repeat domain-containing T4SS effector AnkP (NCBI) | Coxiella burnetii | WP_011997383.1 | 23193298 | |
SS01704 | cagA | type IV secretion system oncogenic effector CagA (NCBI) | Helicobacter pylori | WP_000180788.1 | 23193298 | |
SS01706 | bamC | outer membrane protein assembly factor BamC (NCBI) | Coxiella burnetii | WP_012569937.1 | 23193298 | |
SS01707 | ankG | ankyrin repeat domain-containing T4SS effector AnkG (NCBI) | Coxiella burnetii | WP_012570162.1 | 23193298 | |
SS01708 | ankyrin repeat domain-containing protein (NCBI) | Coxiella burnetii | WP_012570282.1 | 23193298 | ||
SS01709 | ankF | ankyrin repeat domain-containing T4SS effector AnkF (NCBI) | Coxiella burnetii | WP_010957582.1 | 23193298 | |
SS01711 | ankyrin repeat domain-containing protein (NCBI) | Coxiella burnetii | WP_005771199.1 | 23193298 | ||
SS01712 | ankF | ankyrin repeat domain-containing T4SS effector AnkF (NCBI) | Coxiella burnetii | WP_005771371.1 | 23193298 | |
SS01713 | ankyrin repeat domain-containing protein (NCBI) | Coxiella burnetii | WP_005769508.1 | 23193298 | ||
SS01714 | hypothetical protein CBU_0937 (NCBI) | Coxiella burnetii | NP_819950.2 | 23193298 | ||
SS01715 | hypothetical protein CBU_1045a (NCBI) | Coxiella burnetii | YP_002332980.1 | 23193298 | ||
SS01716 | hypothetical protein CBU_1314 (NCBI) | Coxiella burnetii | NP_820305. | 23193298 | ||
SS01717 | hypothetical protein CBU_1379a (NCBI) | Coxiella burnetii | YP_002333001.1 | 23193298 | ||
SS01718 | hypothetical protein CBU_2056 (NCBI) | Coxiella burnetii | NP_821027.2 | 23193298 | ||
SS01720 | hypothetical protein (NCBI) | Coxiella burnetii | WP_011109645.1 | 23193298 | ||
SS01721 | CBUA0020 family Dot/Icm T4SS effector (NCBI) | Coxiella burnetii | WP_012219989.1 | 23193298 | ||
SS01723 | hypothetical protein (NCBI) | Coxiella burnetii | WP_012220000.1 | 23193298 | ||
SS01725 | cagA | type IV secretion system oncogenic effector CagA (NCBI) | Helicobacter pylori | WP_001262965.1 | 23193298 | |
SS01726 | ankH | Dot/Icm T4SS effector AnkH (NCBI) | Coxiella burnetii | WP_011996878.1 | 23193298 | |
SS01727 | YjdF family protein(NCBI) | Coxiella burnetii | WP_011996398.1 | 23193298 | ||
SS01728 | hypothetical protein (NCBI) | Legionella pneumophila | WP_010945770.1 | 23382224 | ||
SS01729 | hypothetical protein (NCBI) | Legionella pneumophila | WP_010945792.1 | 23382224 | ||
SS01730 | RMD1 family protein (NCBI) | Legionella pneumophila | WP_010945868.1 | 23382224 | ||
SS01731 | hypothetical protein (NCBI) | Legionella pneumophila | WP_010945891.1 | 23382224 | ||
SS01732 | hypothetical protein (NCBI) | Legionella pneumophila | WP_010945901.1 | 23382224 | ||
SS01733 | legU1 | Dot/Icm type IV secretion system effector LegU1 (NCBI) | Legionella pneumophila | WP_010945932.1 | 23382224 | |
SS01734 | lpg0172 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010945933.1 | 23382224 | ||
SS01735 | lpg0181 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010945942.1 | 23382224 | ||
SS01736 | ravE | Dot/Icm T4SS effector RavE (NCBI) | Legionella pneumophila | WP_010945956.1 | 23382224 | |
SS01737 | ravF | Dot/Icm T4SS effector RavF (NCBI) | Legionella pneumophila | WP_010945957.1 | 23382224 | |
SS01738 | protein kinase (NCBI) | Legionella pneumophila | WP_010945969.1 | 23382224 | ||
SS01739 | hypothetical protein (NCBI) | Legionella pneumophila | WP_010945970.1 | 23382224 | ||
SS01740 | ravG | Dot/Icm T4SS effector RavG (NCBI) | Legionella pneumophila | WP_010945971.1 | 23382224 | |
SS01741 | ceg9 | Dot/Icm T4SS effector Ceg9 (NCBI) | Legionella pneumophila | WP_010946007.1 | 23382224 | |
SS01742 | hypothetical protein (NCBI) | Legionella pneumophila | WP_010946015.1 | 23382224 | ||
SS01743 | lpg0260 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010946021.1 | 23382224 | ||
SS01744 | Lpg0393 family guanine-nucleotide exchange effector (NCBI) | Legionella pneumophila | WP_010946142.1 | 23382224 | ||
SS01745 | legA7 | Dot/Icm T4SS effector LegA7 (NCBI) | Legionella pneumophila | WP_010946150.1 | 23382224 | |
SS01746 | ankY | Dot/Icm T4SS effector AnkY/LegA9 (NCBI) | Legionella pneumophila | WP_010946151.1 | 23382224 | |
SS01747 | ankG | Dot/Icm T4SS effector AnkG/AnkZ/LegA7 (NCBI) | Legionella pneumophila | WP_010946152.1 | 23382224 | |
SS01748 | lpg0405 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010946154.1 | 23382224 | ||
SS01749 | type I secretion C-terminal target domain-containing protein (NCBI) | Legionella pneumophila | WP_010946382.1 | 23382224 | ||
SS01750 | hypothetical protein (NCBI) | Legionella pneumophila | WP_010946656.1 | 23382224 | ||
SS01751 | ravI | Dot/Icm T4SS effector RavI (NCBI) | Legionella pneumophila | WP_010946661.1 | 23382224 | |
SS01752 | ravJ | Dot/Icm T4SS effector RavJ (NCBI) | Legionella pneumophila | WP_010946679.1 | 23382224 | |
SS01753 | legL1 | Dot/Icm T4SS effector LegL1 (NCBI) | Legionella pneumophila | WP_010946680.1 | 23382224 | |
SS01754 | lpg0967 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010946702.1 | 23382224 | ||
SS01755 | ravK | Dot/Icm T4SS effector RavK (NCBI) | Legionella pneumophila | WP_010946704.1 | 23382224 | |
SS01756 | lpg1083 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010946818.1 | 23382224 | ||
SS01757 | lpg1106 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010946840.1 | 23382224 | ||
SS01758 | ravL | Dot/Icm type IV secretion system effector RavL (NCBI) | Legionella pneumophila | WP_010946842.1 | 23382224 | |
SS01759 | ravM | Dot/Icm T4SS effector RavM (NCBI) | Legionella pneumophila | WP_010946843.1 | 23382224 | |
SS01760 | lem5 | Dot/Icm T4SS effector Lem5 (NCBI) | Legionella pneumophila | WP_010946844.1 | 23382224 | |
SS01761 | ravN | Dot/Icm T4SS effector RavN (NCBI) | Legionella pneumophila | WP_010946845.1 | 23382224 | |
SS01762 | lpg1124 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010946858.1 | 23382224 | ||
SS01763 | ravO | Dot/Icm T4SS effector RavO (NCBI) | Legionella pneumophila | WP_010946863.1 | 23382224 | |
SS01764 | lpg1137 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010946871.1 | 23382224 | ||
SS01765 | Lpg1147 family Dot/Icm T4SS effector N-acetyltransferase (NCBI) | Legionella pneumophila | WP_010946881.1 | 23382224 | ||
SS01766 | ravP | Dot/Icm T4SS effector RavP (NCBI) | Legionella pneumophila | WP_010946886.1 | 23382224 | |
SS01767 | ravQ | Dot/Icm T4SS effector RavQ (NCBI) | Legionella pneumophila | WP_010946888.1 | 23382224 | |
SS01768 | ravR | Dot/Icm T4SS effector RavR (NCBI) | Legionella pneumophila | WP_010946900.1 | 23382224 | |
SS01769 | lpg1171 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010946905.1 | 23382224 | ||
SS01770 | ravS | Dot/Icm T4SS effector RavS (NCBI) | Legionella pneumophila | WP_010946917.1 | 23382224 | |
SS01771 | legC1 | Dot/Icm T4SS effector LegC1 (NCBI) | Legionella pneumophila | WP_010947043.1 | 23382224 | |
SS01772 | ravT | Dot/Icm T4SS effector RavT (NCBI) | Legionella pneumophila | WP_010947047.1 | 23382224 | |
SS01773 | ravW | Dot/Icm T4SS effector RavW (NCBI) | Legionella pneumophila | WP_010947048.1 | 23382224 | |
SS01774 | SGNH/GDSL hydrolase family protein (NCBI) | Legionella pneumophila | WP_010947084.1 | 23382224 | ||
SS01775 | SEL1-like repeat protein (NCBI) | Legionella pneumophila | WP_010947086.1 | 23382224 | ||
SS01776 | glucosyltransferase Lgt1 (NCBI) | Legionella pneumophila | WP_010947098.1 | 23382224 | ||
SS01777 | phosphotransferase family protein (NCBI) | Legionella pneumophila | WP_010947137.1 | 23382224 | ||
SS01778 | lpg1449 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947178.1 | 23382224 | ||
SS01779 | lpg1453 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947182.1 | 23382224 | ||
SS01780 | lpg1484 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947213.1 | 23382224 | ||
SS01781 | ravX | Dot/Icm T4SS effector RavX (NCBI) | Legionella pneumophila | WP_010947218.1 | 23382224 | |
SS01782 | ravY | Dot/Icm T4SS effector RavY (NCBI) | Legionella pneumophila | WP_010947280.1 | 23382224 | |
SS01783 | lpg1578 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947307.1 | 23382224 | ||
SS01784 | legL2 | Dot/Icm T4SS effector LegL2 (NCBI) | Legionella pneumophila | WP_010947329.1 | 23382224 | |
SS01785 | lpg1639 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947366.1 | 23382224 | ||
SS01786 | lpg1654 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947381.1 | 23382224 | ||
SS01787 | lpg1661 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947388.1 | 23382224 | ||
SS01788 | hypothetical protein (NCBI) | Legionella pneumophila | WP_010947390.1 | 23382224 | ||
SS01789 | lpg1666 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947393.1 | 23382224 | ||
SS01790 | lpg1667 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947394.1 | 23382224 | ||
SS01791 | lpg1670 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947397.1 | 23382224 | ||
SS01792 | ravZ | Dot/Icm T4SS effector RavZ (NCBI) | Legionella pneumophila | WP_010947410.1 | 23382224 | |
SS01793 | lpg1684 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947411.1 | 23382224 | ||
SS01794 | lpg1685 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947412.1 | 23382224 | ||
SS01795 | mavA | Dot/Icm T4SS effector MavA (NCBI) | Legionella pneumophila | WP_010947414.1 | 23382224 | |
SS01796 | lpg1692 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947419.1 | 23382224 | ||
SS01797 | legC3 | Dot/Icm type IV secretion system effector LegC3/PpeA (NCBI) | Legionella pneumophila | WP_010947428.1 | 23382224 | |
SS01798 | lpg1716 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947443.1 | 23382224 | ||
SS01799 | ankI | Dot/Icm T4SS effector AnkI/LegAS4 (NCBI) | Legionella pneumophila | WP_010947445.1 | 23382224 | |
SS01800 | lpg1752 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947478.1 | 23382224 | ||
SS01801 | lpg1776 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947502 | 23382224 | ||
SS01802 | rvfA | Dot/Icm T4SS effector RvfA (NCBI) | Legionella pneumophila | WP_010947523.1 | 23382224 | |
SS01803 | mavB | Dot/Icm T4SS effector MavB (NCBI) | Legionella pneumophila | WP_010947524.1 | 23382224 | |
SS01804 | lpg1803 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947529.1 | 23382224 | ||
SS01805 | hypothetical protein (NCBI) | Legionella pneumophila | WP_010947548.1 | 23382224 | ||
SS01806 | ceg25 | Dot/Icm T4SS effector Ceg25 (NCBI) | Legionella pneumophila | WP_010947562.1 | 23382224 | |
SS01807 | Lpg1888 family Dot/Icm type IV secretion system effector (NCBI) | Legionella pneumophila | WP_010947605.1 | 23382224 | ||
SS01808 | lpg1907 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947624.1 | 23382224 | ||
SS01809 | lpg1924 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947641.1 | 23382224 | ||
SS01810 | legC4 | Dot/Icm T4SS effector LegC4 (NCBI) | Legionella pneumophila | WP_010947669.1 | 23382224 | |
SS01811 | lpg1959 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947675.1 | 23382224 | ||
SS01812 | pieF | Dot/Icm T4SS effector PieF (NCBI) | Legionella pneumophila | WP_010947688.1 | 23382224 | |
SS01813 | pieG | Dot/Icm T4SS effector PieG/LegG1 (NCBI) | Legionella pneumophila | WP_010947692.1 | 23382224 | |
SS01814 | setA | Dot/Icm T4SS effector SetA (NCBI) | Legionella pneumophila | WP_010947694.1 | 23382224 | |
SS01815 | lpg1986 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947702.1 | 23382224 | ||
SS01816 | lpg2050 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947766.1 | 23382224 | ||
SS01817 | legK2 | Dot/Icm T4SS effector LegK2 (NCBI) | Legionella pneumophila | WP_010947848.1 | 23382224 | |
SS01818 | F-box-like domain-containing protein (NCBI) | Legionella pneumophila | WP_010947855.1 | 23382224 | ||
SS01819 | mavC | Dot/Icm T4SS effector MavC (NCBI) | Legionella pneumophila | WP_010947858.1 | 23382224 | |
SS01820 | lpg2148 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947859.1 | 23382224 | ||
SS01821 | lpg2149 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947860.1 | 23382224 | ||
SS01822 | lpg2160 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947871.1 | 23382224 | ||
SS01823 | hypothetical protein (NCBI) | Legionella pneumophila | WP_010947875.1 | 23382224 | ||
SS01824 | cegC4 | Dot/Icm T4SS effector CegC4 (NCBI) | Legionella pneumophila | WP_010947908.1 | 23382224 | |
SS01825 | legA2 | Dot/Icm type IV secretion system effector LegA2 (NCBI) | Legionella pneumophila | WP_010947924.1 | 23382224 | |
SS01826 | lpnE | Dot/Icm type IV secretion system effector LpnE (NCBI) | Legionella pneumophila | WP_010947931.1 | 23382224 | |
SS01827 | lpg2223 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947932.1 | 23382224 | ||
SS01828 | ppgA | Dot/Icm T4SS effector PpgA (NCBI) | Legionella pneumophila | WP_010947933.1 | 23382224 | |
SS01829 | lpg2239 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947948.1 | 23382224 | ||
SS01830 | hypothetical protein (NCBI) | Legionella pneumophila | WP_010947953.1 | 23382224 | ||
SS01831 | lpg2271 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010947980.1 | 23382224 | ||
SS01832 | hypothetical protein (NCBI) | Legionella pneumophila | WP_010947992.1 | 23382224 | ||
SS01833 | ankH | Dot/Icm T4SS effector AnkH/LegA3 (NCBI) | Legionella pneumophila | WP_010948006.1 | 23382224 | |
SS01834 | ceg28 | Dot/Icm T4SS effector Ceg28 (NCBI) | Legionella pneumophila | WP_010948017.1 | 23382224 | |
SS01835 | ankK | Dot/Icm T4SS effector AnkK/LegA5 (NCBI) | Legionella pneumophila | WP_010948028.1 | 23382224 | |
SS01836 | mavE | Dot/Icm T4SS effector MavE (NCBI) | Legionella pneumophila | WP_010948050.1 | 23382224 | |
SS01837 | mavF | Dot/Icm T4SS effector MavF (NCBI) | Legionella pneumophila | WP_010948057.1 | 23382224 | |
SS01838 | lpg2359 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948065.1 | 23382224 | ||
SS01839 | lpg2370 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948074.1 | 23382224 | ||
SS01840 | lpg2372 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948076.1 | 23382224 | ||
SS01841 | hypothetical protein (NCBI) | Legionella pneumophila | WP_010948079.1 | 23382224 | ||
SS01842 | lpg2382 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948086.1 | 23382224 | ||
SS01843 | legL6 | Dot/Icm T4SS effector LegL6 (NCBI) | Legionella pneumophila | WP_010948096.1 | 23382224 | |
SS01844 | Lpg2420 family Dot/Icm T4SS effector N-acetyltransferase (NCBI) | Legionella pneumophila | WP_010948124.1 | 23382224 | ||
SS01845 | mavG | Dot/Icm T4SS effector MavG (NCBI) | Legionella pneumophila | WP_010948127.1 | 23382224 | |
SS01846 | mavH | Dot/Icm T4SS effector MavH (NCBI) | Legionella pneumophila | WP_010948128.1 | 23382224 | |
SS01847 | lpg2434 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948137.1 | 23382224 | ||
SS01848 | lpg2443 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948146.1 | 23382224 | ||
SS01849 | mavI | Dot/Icm T4SS effector MavI (NCBI) | Legionella pneumophila | WP_010948147.1 | 23382224 | |
SS01850 | ankF | Dot/Icm T4SS effector AnkF/LegA14/Ceg31 (NCBI) | Legionella pneumophila | WP_010948154.1 | 23382224 | |
SS01851 | ankD | Dot/Icm T4SS effector AnkD/LegA15 (NCBI) | Legionella pneumophila | WP_010948158.1 | 23382224 | |
SS01852 | lpg2461 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948163.1 | 23382224 | ||
SS01853 | mavJ | Dot/Icm T4SS effector MavJ (NCBI) | Legionella pneumophila | WP_010948200.1 | 23382224 | |
SS01854 | lpg2505 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948207.1 | 23382224 | ||
SS01855 | lpg2525 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948227.1 | 23382224 | ||
SS01856 | mavL | Dot/Icm T4SS effector MavL (NCBI) | Legionella pneumophila | WP_010948228.1 | 23382224 | |
SS01857 | lpg2538 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948240.1 | 23382224 | ||
SS01858 | lpg2539 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948241.1 | 23382224 | ||
SS01859 | lpg2541 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948243.1 | 23382224 | ||
SS01860 | lpg2546 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948248.1 | 23382224 | ||
SS01861 | lpg2552 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948254.1 | 23382224 | ||
SS01862 | Lpg2555 family Dot/Icm T4SS effector hydrolase (NCBI) | Legionella pneumophila | WP_010948257.1 | 23382224 | ||
SS01863 | legK3 | Dot/Icm T4SS effector LegK3 (NCBI) | Legionella pneumophila | WP_010948258.1 | 23382224 | |
SS01864 | mavM | Dot/Icm T4SS effector MavM (NCBI) | Legionella pneumophila | WP_010948277.1 | 23382224 | |
SS01865 | lpg2628 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948328.1 | 23382224 | ||
SS01866 | lpg2637 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948337.1 | 23382224 | ||
SS01867 | mavV | Dot/Icm T4SS effector MavV (NCBI) | Legionella pneumophila | WP_010948338.1 | 23382224 | |
SS01868 | lpg2692 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948392.1 | 23382224 | ||
SS01869 | lpg2745 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948443.1 | 23382224 | ||
SS01870 | hypothetical protein (NCBI) | Legionella pneumophila | WP_010948493.1 | 23382224 | ||
SS01871 | iroT | T4SS effector ferrous iron transporter IroT/MavN (NCBI) | Legionella pneumophila | WP_010948502.1 | 23382224 | |
SS01872 | lpg2828 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948515.1 | 23382224 | ||
SS01873 | lpg2832 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948519.1 | 23382224 | ||
SS01874 | lpg2844 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948531.1 | 23382224 | ||
SS01875 | lpg2879 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948565.1 | 23382224 | ||
SS01876 | lpg2884 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948570.1 | 23382224 | ||
SS01877 | lpg2885 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948571.1 | 23382224 | ||
SS01878 | lpg2888 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948574.1 | 23382224 | ||
SS01879 | hypothetical protein (NCBI) | Legionella pneumophila | WP_010948592.1 | 23382224 | ||
SS01880 | lpg2912 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948597.1 | 23382224 | ||
SS01881 | Lpg2936 family Dot/Icm T4SS effector methyltransferase (NCBI) | Legionella pneumophila | WP_010948621.1 | 23382224 | ||
SS01882 | lpg2975 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948659.1 | 23382224 | ||
SS01883 | legP | Dot/Icm T4SS effector LegP (NCBI) | Legionella pneumophila | WP_010948683.1 | 23382224 | |
SS01884 | lpg3000 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010948684.1 | 23382224 | ||
SS01885 | hypothetical protein CBU_0388 (NCBI) | Coxiella burnetii | NP_819427.1 | 24064423 | ||
SS01886 | hypothetical protein CBU_0626 (NCBI) | Coxiella burnetii | NP_819656.1 | 24064423 | ||
SS01887 | hypothetical protein CBU_0885 (NCBI) | Coxiella burnetii | NP_819902.2 | 24064423 | ||
SS01888 | hypothetical protein CBU_1686 (NCBI) | Coxiella burnetii | NP_820668.1 | 24064423 | ||
SS01889 | hypothetical protein CBU_1724 (NCBI) | Coxiella burnetii | NP_820705.1 | 24064423 | ||
SS01890 | hypothetical protein (NCBI) | Brucella melitensis | WP_002963813.1 | 24064423 | ||
SS01891 | vipE | Dot/Icm T4SS effector VipE (NCBI) | Legionella pneumophila | WP_010948500.1 | 24447430 | |
SS01892 | wipC | Dot/Icm T4SS effector WipC(NCBI) | Legionella pneumophila | WP_010947915.1 | 24447430 | |
SS01893 | ribosome-associated protein (NCBI) | Legionella pneumophila | WP_010945783.1 | 24447430 | ||
SS01894 | hypothetical protein (NCBI) | Legionella pneumophila | WP_010945803.1 | 24447430 | ||
SS01895 | hypothetical protein (NCBI) | Legionella pneumophila | WP_010945808.1 | 24447430 | ||
SS01896 | hypothetical protein (NCBI) | Legionella pneumophila | WP_010945821.1 | 24447430 | ||
SS01897 | hypothetical protein (NCBI) | Legionella pneumophila | WP_010945921.1 | 24447430 | ||
SS01898 | ABC transporter permease (NCBI) | Legionella pneumophila | WP_010945931.1 | 24447430 | ||
SS01899 | Lpg0257 family Dot/Icm type IV secretion system effector (NCBI) | Legionella pneumophila | WP_010946018.1 | 24447430 | ||
SS01900 | legY | Dot/Icm T4SS effector LegY (NCBI) | Legionella pneumophila | WP_010946171.1 | 24447430 | |
SS01901 | legD2 | Dot/Icm T4SS effector LegD2 (NCBI) | Legionella pneumophila | WP_010946263.1 | 24447430 | |
SS01902 | lpg0716 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010946453.1 | 24447430 | ||
SS01903 | ravH | Dot/Icm T4SS effector RavH (NCBI) | Legionella pneumophila | WP_010946470.1 | 24447430 | |
SS01904 | lpg0796 family Dot/Icm T4SS effector (NCBI) | Legionella pneumophila | WP_010946533.1 | 24447430 | ||
SS01905 | legT | Dot/Icm T4SS effector LegT (NCBI) | Legionella pneumophila | WP_010947059.1 | 24447430 | |
SS01906 | legS1 | Dot/Icm T4SS effector LegS1 (NCBI) | Legionella pneumophila | WP_010948288.1 | 24447430 | |
SS01907 | legD1 | Dot/Icm type IV secretion system effector LegD1 (NCBI) | Legionella pneumophila | WP_010948394.1 | 24447430 | |
SS01908 | legN | Dot/Icm type IV secretion system effector LegN (NCBI) | Legionella pneumophila | WP_010948419.1 | 24447430 | |
SS01909 | IS110-like element IS1111A family transposase (NCBI) | Coxiella burnetii | WP_005772222.1 | 24447430 | ||
SS01910 | coxCC15 | Dot/Icm T4SS effector CoxCC15 (NCBI) | Coxiella burnetii | WP_012220016.1 | 24447430 | |
SS01912 | ankA | ankyrin repeat domain-containing T4SS effector AnkA (NCBI) | Coxiella burnetii | WP_012220077.1 | 24447430 | |
SS01913 | mceA | Dot/Icm T4SS effector MceA (NCBI) | Coxiella burnetii | WP_012220080.1 | 24447430 | |
SS01914 | hypothetical protein (NCBI) | Coxiella burnetii | WP_012220099.1 | 24447430 | ||
SS01915 | ankB | ankyrin repeat domain-containing T4SS effector AnkB (NCBI) | Coxiella burnetii | WP_012220107.1 | 24447430 | |
SS01916 | coxK1 | Dot/Icm T4SS effector protein kinase CoxK1 (NCBI) | Coxiella burnetii | WP_005772950.1 | 24447430 | |
SS01917 | CBU_0270 family Dot/Icm type IV secretion system effector (NCBI) | Coxiella burnetii | WP_010957471.1 | 24447430 | ||
SS01918 | phosphomannomutase/phosphoglucomutase (NCBI) | Coxiella burnetii | WP_012220155.1 | 24447430 | ||
SS01919 | coxCC3 | Dot/Icm T4SS effector CoxCC3 (NCBI) | Coxiella burnetii | WP_012220207.1 | 24447430 | |
SS01920 | hypothetical protein (NCBI) | Coxiella burnetii | WP_005771948.1 | 24447430 | ||
SS01921 | CBU_0425 family Dot/Icm T4SS effector (NCBI) | Coxiella burnetii | WP_012220212.1 | 24447430 | ||
SS01925 | coxCC5 | Dot/Icm T4SS effector CoxCC5 (NCBI) | Coxiella burnetii | WP_010957865.1 | 24447430 | |
SS01926 | rimI | ribosomal protein S18-alanine N-acetyltransferase RimI/CoxH2 (NCBI) | Coxiella burnetii | WP_005768924.1 | 24447430 | |
SS01927 | coxCC4 | Dot/Icm T4SS effector CoxCC4 (NCBI) | Coxiella burnetii | WP_012220474.1 | 24447430 | |
SS01929 | membrane protein (NCBI) | Coxiella burnetii | WP_012220554.1 | 24447430 | ||
SS01930 | bamC | outer membrane protein assembly factor BamC (NCBI) | Coxiella burnetii | WP_012220557.1 | 24447430 | |
SS01932 | protein kinase (NCBI) | Coxiella burnetii | WP_012220629.1 | 24447430 | ||
SS01934 | coxDFB4 | Dot/Icm type IV secretion system effector CoxDFB4 (NCBI) | Coxiella burnetii | WP_005771746.1 | 24447430 | |
SS01935 | hypothetical protein (NCBI) | Coxiella burnetii | WP_012220693.1 | 24447430 | ||
SS01936 | coxCC10 | Dot/Icm T4SS effector CoxCC10 (NCBI) | Coxiella burnetii | WP_012220701.1 | 24447430 | |
SS01937 | coxCC11 | Dot/Icm T4SS effector CoxCC11 (NCBI) | Coxiella burnetii | WP_010958299.1 | 24447430 | |
SS01939 | Dot/Icm T4SS effector CoxDFB5 (NCBI) | Coxiella burnetii | WP_012220780.1 | 24447430 | ||
SS01940 | ankyrin repeat domain-containing protein (NCBI) | Coxiella burnetii | WP_012220782.1 | 24447430 | ||
SS01941 | coxH3 | Dot/Icm type IV secretion system effector CoxH3 (NCBI) | Coxiella burnetii | WP_005770384.1 | 24447430 | |
SS01942 | coxH4 | Dot/Icm T4SS effector CoxH4 (NCBI) | Coxiella burnetii | WP_012220816.1 | 24447430 | |
SS01943 | coxDFB6 | Dot/Icm T4SS effector CoxDFB6 (NCBI) | Coxiella burnetii | WP_005772185.1 | 24447430 | |
SS01944 | inorganic phosphate transporter (NCBI) | Coxiella burnetii | WP_012220885.1 | 24447430 | ||
SS01945 | coxFIC1 | Dot/Icm type IV secretion system effector CoxFIC1 (NCBI) | Coxiella burnetii | WP_012220895.1 | 24447430 | |
SS01946 | cyclic nucleotide-binding domain-containing protein (NCBI) | Ochrobactrum anthropi | WP_012091151.1 | 24447430 | ||
SS01947 | gamma carbonic anhydrase family protein (NCBI) | Ochrobactrum anthropi | WP_012091901.1 | 24447430 | ||
SS01950 | hypothetical protein (NCBI) | Ochrobactrum anthropi | WP_012093522.1 | 24447430 | ||
SS01951 | orf_Bo210 (plasmid) (NCBI) | Agrobacterium tumefaciens | YP_001967606.1 | 24447430 | ||
SS01953 | PepSY domain-containing protein (NCBI) | Brucella pinnipedialis | WP_002964730.1 | 24447430 | ||
SS01954 | Chain B, Crystal Structure Of Legk4_apo Kinase (NCBI) | Legionella pneumophila | 5CLR_B | 26419332 | ||
SS01955 | ralF | RalF (NCBI) | Legionella pneumophila | AAL23711.1 | 26291822 | |
SS01957 | virB11 | VirB11 (NCBI) | Bartonella henselae | AFK10355.1 | 25474545 | |
SS01958 | traN | conjugal transfer mating pair stabilization protein TraN (plasmid) (NCBI) | Escherichia coli | NP_862934.1 | 25195751 | |
SS01959 | traK | conjugal transfer protein TraK (plasmid) (NCBI) | Escherichia coli | NP_957603.1 | 24914183 | |
SS01960 | ankG | ankyrin protein, substrate of the Dot/Icm secretion system (NCBI) | Legionella pneumophila | CCD07726.1 | 24733095 | |
SS01961 | CaeA (NCBI) | Mycobacterium tuberculosis | ALB19409.1 | 23126667 | ||
SS02462 | Smlt4383 | Smlt4383 | Stenotrophomonas maltophilia (strain K279a) | B2FKS6 | WP_012481484.1 | 31513674 |
SS02463 | Smlt4012 | Smlt4012 (Reference) | Stenotrophomonas maltophilia (strain K279a) | B2FUP9 | WP_012481267.1 | 31513674 |
SS02464 | Smlt3024 | Smlt3024 (Reference) | Stenotrophomonas maltophilia (strain K279a) | B2FJJ5 | PJL13822.1 | 31513674 |
SS02465 | Smlt2992 | Smlt2992 (Reference) | Stenotrophomonas maltophilia (strain K279a) | B2FJG3 | AYZ70607.1 | 31513674 |
SS02466 | Smlt2990 | Smlt2990 (Reference) | Stenotrophomonas maltophilia (strain K279a) | B2FJG1 | WP_005410111.1 | 31513674 |
SS02467 | Smlt0505 | Smlt0505 (Reference) | Stenotrophomonas maltophilia (strain K279a) | B2FKX6 | CAQ44095.1 | 31513674 |
SS02468 | Smlt0502 | Smlt0502 (Reference) | Stenotrophomonas maltophilia (strain K279a) | B2FKX3 | PJL24813.1 | 31513674 |
SS02469 | Smlt0500 | Smlt0500 (Reference) | Stenotrophomonas maltophilia (strain K279a) | B2FKX1 | WP_012478977.1 | 31513674 |
SS02470 | Smlt0332 | Smlt0332 (Reference) | Stenotrophomonas maltophilia (strain K279a) | B2FJ05 | WP_012478868.1 | 31513674 |
SS02471 | Smlt0273 | Smlt0273 (Reference) | Stenotrophomonas maltophilia (strain K279a) | B2FI89 | PJL25731.1 | 31513674 |
SS02472 | Smlt0193 | Smlt0193 (Reference) | Stenotrophomonas maltophilia (strain K279a) | B2FHF9 | WP_138970253.1 | 31513674 |
SS02473 | Smlt0113 | Smlt0113 (Reference) | Stenotrophomonas maltophilia (strain K279a) | B2FU71 | WP_012478700.1 | 31513674 |
T6SS substrate
BastionHub ID | Gene Name | Brief Description
![]() |
Species | UniProt ID | NCBI ID | PubMed ID |
---|---|---|---|---|---|---|
SS01962 | vgrG1 | Actin cross-linking toxin VgrG1 (UniProt) | Vibrio cholerae | A0A0H3AIG7 | WP_000212118.1 | |
SS01963 | AHA_1119 | Rhs element Vgr protein (UniProt) | Aeromonas hydrophila | A0KHA9 | WP_011705045.1 | 25640659 |
SS01964 | Aave_0030 | BPSL0067 family protein (NCBI) | Acidovorax citrulli | A1TI59 | WP_011793225.1 | 22607806 |
SS01965 | Aave_1502 | BPSL0067 family protein (NCBI) | Acidovorax citrulli | A1TMA4 | WP_011794642.1 | 22607806 |
SS01966 | Aave_2422 | BPSL0067 family protein (NCBI) | Acidovorax citrulli | A1TPV9 | WP_011795529.1 | 22607806 |
SS01967 | Aave_4757 | hypothetical protein Aave_4757 (NCBI) | Acidovorax citrulli | A1TWF0 | ABM35288.1 | 22607806 |
SS01968 | BURPS668_0080 | BPSL0067 family protein (NCBI) | Burkholderia pseudomallei | A3N464 | WP_004553735.1 | 22607806 |
SS01969 | ESA_03935 | type VI secretion system amidase effector protein Tae4 (NCBI) | Cronobacter sakazakii | A7MQ14 | WP_012126156.1 | 22607806 |
SS01970 | CKO_00829 | NLPC_P60 domain-containing protein (UniProt) | Citrobacter koseri | A8AER8 | ABV11981.1 | 22607806 |
SS01971 | CKO_01385 | hypothetical protein CKO_01385 (NCBI) | Citrobacter koseri | A8AGA8 | ABV12521.1 | 22607806 |
SS01972 | Daci_3854 | Putative cytoplasmic protein (UniProt, NCBI) | Delftia acidovorans | A9BLK0 | ABX36485.1 | 22607806 |
SS01973 | Daci_4291 | Putative cytoplasmic protein (UniProt, NCBI) | Delftia acidovorans | A9BLY3 | ABX36922.1 | 22607806 |
SS01974 | ABSDF_p20032 | hypothetical protein ABSDF_p20032 (NCBI) | Acinetobacter baumannii | B0VVE2 | CAP02972.1 | 22607806 |
SS01975 | BamMC406_0673 | BPSL0067 family protein (NCBI) | Burkholderia ambifaria | B1YTK4 | WP_012363155.1 | 22607806 |
SS01976 | Bphyt_0467 | Putative cytoplasmic protein (UniProt) | Paraburkholderia phytofirmans | B2SWU8 | WP_012431535.1 | 22607806 |
SS01977 | Bphyt_5187 | conserved hypothetical protein (NCBI) | Paraburkholderia phytofirmans | B2TCX2 | ACD19546.1 | 22607806 |
SS01978 | ETA_06210 | type VI secretion system amidase effector protein Tae4 (NCBI) | Erwinia tasmaniensis | B2VH84 | WP_012440370.1 | 22607806 |
SS01979 | Rpic12D_3260 | Putative cytoplasmic protein (UniProt) | Ralstonia pickettii | C6BHF2 | WP_015855995.1 | 22607806 |
SS01980 | Ctu_30570 | hypothetical protein CTU_30570 (NCBI) | Cronobacter turicensis | C9XXJ5 | CBA32722.1 | 22607806 |
SS01981 | Ctu_32660 | hypothetical protein CTU_32660 (NCBI) | Cronobacter turicensis | C9XYW6 | CBA33145.1 | 22607806 |
SS01982 | Ctu_33040 | hypothetical protein CTU_33040 (NCBI) | Cronobacter turicensis | C9XZ04 | CBA33222.1 | 22607806 |
SS01983 | ENTCAN_06548 | hypothetical protein ENTCAN_06548 (NCBI) | Enterobacter cancerogenus | D2ZDL2 | EFC56680.1 | 22607806 |
SS01984 | HMPREF0758_3166 | type VI secretion system amidase effector protein Tae4 (NCBI) | Serratia odorifera DSM 4582. | D4E4R6 | WP_004961376.1 | 22607806 |
SS01985 | EAMY_3018 | type VI secretion system amidase effector protein Tae4 (NCBI) | Erwinia amylovora | D4I0Q7 | WP_004159897.1 | 22607806 |
SS01986 | BC1002_0678 | BPSL0067 family protein (NCBI) | Burkholderia sp. | D5WCZ6 | WP_013088666.1 | 22607806 |
SS01987 | ECEG_03250 | type VI secretion system amidase effector protein Tae4 (NCBI) | Escherichia coli | D6J6Z7 | WP_000533467.1 | 22607806 |
SS01989 | vgrGA | Putative type VI secretion system protein VgrGA (UniProt) | Dickeya dadantii | E0SAL0 | WP_013316544.1 | |
SS01990 | vgrGB | Putative type VI secretion system protein VgrGB (UniProt) | Dickeya dadantii | E0SIS4 | WP_013318571.1 | |
SS01991 | GM18_4341 | hypothetical protein GM18_4341 (NCBI) | Geobacter sp. | E8WJ67 | ADW15752.1 | 22607806 |
SS01992 | Acav_4746 | hypothetical protein Acav_4746 (NCBI) | Acidovorax avenae | F0QCN5 | ADX48624.1 | 22607806 |
SS01993 | HMPREF9086_2717 | type VI secretion system amidase effector protein Tae4 (NCBI) | Enterobacter hormaechei | F5RYK9 | WP_006810953.1 | 22607806 |
SS01994 | DelCs14_2971 | Putative cytoplasmic protein (UniProt) | Delftia sp. | F6AQK3 | MPT03606.1 | 22607806 |
SS01996 | TASI_0128 | hypothetical protein TASI_0128 (NCBI) | Taylorella asinigenitalis | G4QDA2 | AEP35919.1 | 22607806 |
SS01997 | sciK | Hcp1 family type VI secretion system effector (UniProt) | Salmonella enterica | H9L4J2 | 25640659 | |
SS01998 | VC_1415 | Hcp protein (UniProt) | Vibrio cholerae | H9L4Q3 | WP_001142947.1 | 25640659 |
SS01999 | Bxe_B1040 | Uncharacterized protein (UniProt) | Burkholderia xenovorans | Q13LX5 | 22607806 | |
SS02000 | Bxe_A2093 | Uncharacterized protein (UniProt) | Burkholderia xenovorans | Q13YG4 | 22607806 | |
SS02001 | BTH_I0068 | BPSL0067 family protein (NCBI) | Burkholderia thailandensis | Q2T2K7 | WP_009902034.1 | 22607806 |
SS02006 | PFL_5498 | Uncharacterized protein (UniProt) | Pseudomonas fluorescens | Q4K5B7 | 22607806 | |
SS02007 | Psyr_4040 | Putative cytoplasmic protein (UniProt) | Pseudomonas syringae | Q4ZP52 | WP_011268807.1 | 22607806 |
SS02008 | STY2606 | NlpC/P60 enzyme (UniProt) | Salmonella enterica | Q8Z4Z6 | pir|AE0803| | 22607806 |
SS02009 | STY0300 | Uncharacterised protein (UniProt) | Salmonella enterica | Q8Z969 | 22607806 | |
SS02011 | STM0277 | type VI secretion system amidase effector protein Tae4 (NCBI) | Salmonella enterica | Q93IS4 | WP_001081550.1 | 22607806 |
SS02012 | tse1 | Peptidoglycan amidase Tse1 (UniProt) | Pseudomonas aeruginosa | Q9I2Q1 | WP_003088027.1 | 25640659 |
SS02013 | vgrG1 | Actin cross-linking toxin VgrG1 (UniProt) | Vibrio cholerae | Q9KS45 | MDSLDQCIVNACKNSWDKSYLAGTPNKDNCSGFVQSVAAELGVPMPRGNANAMVDGLEQSWTKLASGAEAAQKAAQGFLVIAGLKGRTYGHVAVVISGPL | |
SS02014 | Hcp family type VI secretion system effector (NCBI) | Burkholderia mallei | WP_004200972.1 | 25640659 | ||
SS02015 | hypothetical protein PA2702 (NCBI) | Pseudomonas aeruginosa | AAG06090.1 | 25640659 | ||
SS02016 | hypothetical protein PA3484 (NCBI) | Pseudomonas aeruginosa PAO1 | AAG06872.1 | 25640659 | ||
SS02017 | conserved hypothetical protein (NCBI) | Helicobacter hepaticus | AAP76840.1 | 25640659 | ||
SS02018 | hcp1 | Protein hcp1 (UniProt) | Pseudomonas aeruginosa | Q9I747 | WP_003083670.1 | |
SS02019 | hypothetical protein HH_0242 (NCBI) | Helicobacter hepaticus | AAP76839.1 | 25640659 | ||
SS02020 | hypothetical protein BMAA0729 (NCBI) | Burkholderia mallei | AAY59304.1 | 25640659 | ||
SS02021 | hypothetical protein (NCBI) | Vibrio cholerae | WP_000070352.1 | 25640659 | ||
SS02022 | tagO | type VI secretion system-associated protein TagO (NCBI) | Vibrio cholerae | WP_001882968.1 | 25640659 | |
SS02023 | evpP | EvpP (NCBI) | Edwardsiella tarda | ACR24239.1 | 25640659 | |
SS02024 | conserved hypothetical protein (NCBI) | Burkholderia thailandensis | ABC38716.1 | 25640659 | ||
SS02025 | Rhs element Vgr protein, putative (NCBI) | Burkholderia thailandensis | ABC34634.1 | 25640659 | ||
SS02026 | Rhs element Vgr protein, putative (NCBI) | Burkholderia thailandensis | ABC36513.1 | 25640659 | ||
SS02027 | Rhs element Vgr protein, putative (NCBI) | Burkholderia thailandensis | ABC38017.1 | 25640659 | ||
SS02028 | Rhs element Vgr protein, putative (NCBI) | Burkholderia thailandensis | ABC36370.1 | 25640659 | ||
SS02029 | Rhs element Vgr protein (NCBI) | Burkholderia thailandensis | ABC36714.1 | 25640659 | ||
SS02030 | conserved hypothetical protein (NCBI) | Burkholderia thailandensis | ABC39416.1 | 25640659 | ||
SS02031 | antifungal protein precursor, putative (NCBI) | Burkholderia thailandensis | ABC34803.1 | 25640659 | ||
SS02032 | conserved hypothetical protein (NCBI) | Burkholderia thailandensis | ABC38949.1 | 25640659 | ||
SS02033 | conserved hypothetical protein (NCBI) | Burkholderia thailandensis | ABC37431.1 | 25640659 | ||
SS02034 | conserved hypothetical protein (NCBI) | Burkholderia thailandensis | ABC33998.1 | 25640659 | ||
SS02035 | hypothetical protein BTH_I2691 (NCBI) | Burkholderia thailandensis | ABC38088.1 | 25640659 | ||
SS02036 | Hcp family type VI secretion system effector (NCBI) | Pseudomonas syringae | WP_011105495.1 | 25640659 | ||
SS02037 | hypothetical protein PA2685 (NCBI) | Pseudomonas aeruginosa | NP_251375.1 | 25640659 | ||
SS02038 | rbsB | ribose ABC transporter substrate-binding protein RbsB (NCBI) | Bacillus amyloliquefaciens | ABS75643.1 | 25640659 | |
SS02039 | evpC | EvpC (NCBI) | Edwardsiella tarda | AAR83929.1 | 25640659 | |
SS02040 | tssI | type VI secretion system tip protein VgrG (NCBI) | Vibrio cholerae | WP_000113295.1 | 25640659 | |
SS02041 | vgrG protein (NCBI) | Vibrio cholerae | AAF94573.1 | 25640659 | ||
SS02042 | hypothetical protein (NCBI) | Francisella tularensis | WP_003016192.1 | 25640659 | ||
SS02043 | hypothetical protein (NCBI) | Francisella tularensis | WP_003016179.1 | 25640659 | ||
SS02044 | putative type VI secretion protein (NCBI) | Escherichia coli | CBG37385.1 | 25640659 | ||
SS02045 | conserved hypothetical protein (NCBI) | Francisella tularensis | CAJ78559.1 | 25640659 | ||
SS02046 | putative type VI secretion protein (NCBI) | Escherichia coli | CBG37351.1 | 25640659 | ||
SS02047 | type VI secretion system tube protein Hcp (NCBI) | Agrobacterium tumefaciens | WP_003504561.1 | 25640659 | ||
SS02048 | conserved hypothetical protein (NCBI) | Pectobacterium atrosepticum | CAG76327.1 | 25640659 | ||
SS02049 | conserved hypothetical protein (NCBI) | Pectobacterium atrosepticum | CAG76328.1 | 25640659 | ||
SS02050 | evpI | EvpI (NCBI) | Edwardsiella tarda | ABW69081.1 | 25640659 | |
SS02051 | protein of unknown function DUF796 (NCBI) | Pseudomonas fluorescens | ACA69830.1 | 25640659 | ||
SS02052 | Hcp-2 hemolysin-coregulated protein (NCBI) | Aeromonas hydrophila | ABG57132.1 | 25640659 | ||
SS02053 | type VI secretion system effector, Hcp1 family (NCBI) | Pectobacterium carotovorum | ACT11497.1 | 25640659 | ||
SS02054 | type VI secretion system effector, Hcp1 family (NCBI) | Dickeya chrysanthemi | ACT07649.1 | 25640659 | ||
SS02055 | type VI secretion system effector, Hcp1 family (NCBI) | Pectobacterium wasabiae | ACX85929.1 | 25640659 | ||
SS02056 | protein of unknown function (NCBI) | Francisella tularensis | ABK90193.1 | 25640659 | ||
SS02057 | conserved hypothetical protein (NCBI) | Francisella tularensis | ABK90188.1 | 25640659 | ||
SS02058 | vgrG2 | VgrG-2 protein (NCBI) | Aeromonas hydrophila | ABG57133.1 | 25640659 | |
SS02059 | vgrG3 | VgrG-3 protein (NCBI) | Aeromonas hydrophila | ABG57151.1 | 25640659 | |
SS02060 | uncharacterized hemolysin-coregulated protein (NCBI) | Vibrio alginolyticus | ACN89305.1 | 25640659 | ||
SS02061 | conserved hypothetical protein (NCBI) | Pseudomonas protegens | AAY94704.1 | 25640659 | ||
SS02062 | cts1H | Hcp family T6SS protein Cts1H (NCBI) | Citrobacter rodentium | CBG89517.1 | 25640659 | |
SS02063 | type VI secretion system Vgr family protein (NCBI) | Pseudomonas fluorescens | ACA69825.1 | 25640659 | ||
SS02064 | lipase (NCBI) | Vibrio cholerae | WP_000376836.1 | 25640659 | ||
SS02065 | hypothetical protein A1S_1296 (NCBI) | Acinetobacter baumannii | ABO11724.1 | 25640659 | ||
SS02066 | pldA | phospholipase D (NCBI) | Pseudomonas aeruginosa | AAG06875.1 | 25640659 | |
SS02067 | type VI secretion system amidase effector protein Tae4 (NCBI) | Agrobacterium tumefaciens | WP_006315890.1 | 25640659 | ||
SS02068 | conserved hypothetical protein (NCBI) | Pseudomonas protegens | AAY92307.1 | 25640659 | ||
SS02069 | idsD | IdsD (NCBI) | Proteus mirabilis | AGS61453.1 | 25640659 | |
SS02070 | idsA | IdsA (NCBI) | Proteus mirabilis | AGS61450.1 | 25640659 | |
SS02071 | idsB | IdsB (NCBI) | Proteus mirabilis | AGS61451.1 | 25640659 | |
SS02072 | idrB | IdrB (NCBI) | Proteus mirabilis | AGS59319.1 | 25640659 | |
SS02073 | hypothetical protein PA0093 (NCBI) | Pseudomonas aeruginosa | NP_248783.1 | 25640659 | ||
SS02074 | hypothetical protein PA2684 (NCBI) | Pseudomonas aeruginosa | NP_251374.1 | 25640659 | ||
SS02075 | hypothetical protein PA2774 (NCBI) | Pseudomonas aeruginosa | NP_251464.1 | 25640659 | ||
SS02076 | hypothetical protein PA5089 (NCBI) | Pseudomonas aeruginosa | NP_253776.1 | 25640659 | ||
SS02077 | S-type pyocin domain-containing protein (NCBI) | Vibrio parahaemolyticus | WP_011106455.1 | 25640659 | ||
SS02078 | hypothetical protein (NCBI) | Vibrio parahaemolyticus | WP_011105821.1 | 25640659 | ||
SS02079 | DUF4150 domain-containing protein (NCBI) | Vibrio parahaemolyticus | WP_005493834.1 | 25640659 | ||
SS02080 | hypothetical protein V12G01_02265 (NCBI) | Vibrio alginolyticus | EAS77247.1 | 25640659 | ||
SS02081 | DUF4150 domain-containing protein (NCBI) | Agrobacterium tumefaciens | WP_010973208.1 | 25640659 | ||
SS02082 | hypothetical protein (NCBI) | Agrobacterium tumefaciens | WP_010973767.1 | 25640659 | ||
SS02083 | hypothetical protein (NCBI) | Flavobacterium johnsoniae | WP_012025242.1 | 25640659 | ||
SS02084 | hypothetical protein (NCBI) | Flavobacterium johnsoniae | WP_012025259.1 | 25640659 | ||
SS02085 | type IV secretion protein Rhs (NCBI) | Flavobacterium johnsoniae | WP_012025245.1 | 25640659 | ||
SS02086 | hypothetical protein (NCBI) | Flavobacterium johnsoniae | WP_012025247.1 | 25640659 | ||
SS02087 | RHS domain-containing protein (NCBI) | Enterobacter cloacae | WP_013096205.1 | 25640659 | ||
SS02088 | PAAR domain-containing protein (NCBI) | Enterobacter cloacae | WP_013097665.1 | 25640659 | ||
SS02089 | tssI | type VI secretion system tip protein VgrG (NCBI) | Burkholderia thailandensis | WP_009896187.1 | 25640659 | |
SS02090 | Hcp family type VI secretion system effector (NCBI) | Burkholderia thailandensis | WP_009896195.1 | 25640659 | ||
SS02091 | type VI secretion system tube protein Hcp (NCBI) | Acinetobacter baumannii | WP_000653195.1 | 25640659 | ||
SS02092 | type VI secretion system tube protein Hcp (NCBI) | Acinetobacter sp. ADP1 | WP_004929007.1 | 25640659 | ||
SS02098 | conserved protein of unknown function, aromatic compound dioxygenase domain (plasmid) (NCBI) | Ralstonia solanacearum | YP_003748701.1 | 23552891 | ||
SS02099 | DUF2235 domain-containing protein (NCBI) | Burkholderia thailandensis | WP_011402454.1 | 23552891 | ||
SS02101 | DUF2235 domain-containing protein (NCBI) | Serratia proteamaculans | WP_012006220.1 | 23552891 | ||
SS02102 | DUF2235 domain-containing protein (NCBI) | Klebsiella pneumoniae | WP_004224376.1 | 23552891 | ||
SS02103 | DUF2235 domain-containing protein (NCBI) | Enterobacter aerogenes | WP_015705640.1 | 23552891 | ||
SS02104 | hypothetical protein PA3290 (NCBI) | Pseudomonas aeruginosa | NP_251980.1 | 23552891 | ||
SS02105 | DUF2235 domain-containing protein (NCBI) | Chromobacterium violaceum | WP_011133567.1 | 23552891 | ||
SS02106 | pdl1 | Pdl1 (NCBI) | Photorhabdus luminescens | AAL18491.1 | 23552891 | |
SS02107 | lipase family protein (NCBI) | Xenorhabdus bovienii | WP_012988017.1 | 23552891 | ||
SS02108 | lipase family protein (NCBI) | Proteus mirabilis | WP_012367965.1 | 23552891 | ||
SS02110 | lipase (NCBI) | Pseudomonas syringae | WP_011104583.1 | 23552891 | ||
SS02111 | lipase family protein (NCBI) | Pseudomonas fluorescens | WP_011331864.1 | 23552891 | ||
SS02112 | lipase (NCBI) | Pseudomonas entomophila | WP_011536446.1 | 23552891 | ||
SS02114 | DUF3274 domain-containing protein (NCBI) | Azoarcus sp. | WP_011767193.1 | 23552891 | ||
SS02115 | DUF3274 domain-containing protein (NCBI) | Pseudomonas syringae | WP_011105290.1 | 23552891 | ||
SS02116 | DUF3274 domain-containing protein (NCBI) | Xanthomonas oryzae | WP_012445925.1 | 23552891 | ||
SS02118 | hypothetical protein PA0260 (NCBI) | Pseudomonas aeruginosa | NP_248951.1 | 23552891 | ||
SS02119 | DUF3274 domain-containing protein (NCBI) | Enterobacter cloacae | WP_014882523.1 | 23552891 | ||
SS02120 | hypothetical protein (NCBI) | Escherichia coli | WP_000106189.1 | 23552891 | ||
SS02121 | hypothetical protein (NCBI) | Erwinia billingiae | WP_013203950.1 | 23552891 | ||
SS02122 | conserved protein of unknown function, hydrolase domain (plasmid) (NCBI) | Ralstonia solanacearum | YP_003748324.1 | 23552891 | ||
SS02123 | hypothetical protein PA1510 (NCBI) | Pseudomonas aeruginosa | NP_250201.1 | 23552891 | ||
SS02124 | alpha/beta hydrolase (NCBI) | Burkholderia cenocepacia | WP_011695165.1 | 23552891 | ||
SS02125 | acetyltransferase (NCBI) | Erwinia billingiae | WP_013200451.1 | 23552891 | ||
SS02126 | PGAP1-like protein (NCBI) | Enterobacter cloacae | CBK84496.1 | 23552891 | ||
SS02127 | hypothetical protein (NCBI) | Escherichia coli | WP_000204766.1 | 23552891 | ||
SS02128 | hypothetical protein (NCBI) | Xanthomonas oryzae | WP_014504343.1 | 23552891 | ||
SS02129 | putative phospholipase protein (plasmid) (NCBI) | Ralstonia solanacearum | YP_003747859.1 | 23552891 | ||
SS02130 | phospholipase (NCBI) | Chromobacterium violaceum | WP_011134789.1 | 23552891 | ||
SS02131 | phospholipase (NCBI) | Aggregatibacter aphrophilus | WP_012771255.1 | 23552891 | ||
SS02132 | phospholipase D (NCBI) | Pseudomonas aeruginosa | NP_252177.1 | 23552891 | ||
SS02133 | phospholipase (NCBI) | Cupriavidus taiwanensis | WP_012355863.1 | 23552891 | ||
SS02134 | Hcp3 (Reference); type VI secretion system effector Hcp3 (NCBI) | Pseudomonas fluorescens | EIK66646.1 | 26460929;25663006 | ||
SS02135 | evpC | type VI secretion system protein EvpC (NCBI) | Edwardsiella tarda | AIJ06941.1 | 25663006 | |
SS02136 | evpP | EvpP (Reference, NCBI) | Edwardsiella tarda | ACR24234.1 | 25042941;19563898 | |
SS02138 | vgrG3 | VgrG3(Reference); type VI secretion protein VgrG3 (NCBI) | Pseudomonas fluorescens | EJL01728.1 | 25042941;24331463 | |
SS02139 | Chain F, Crystal Structure Of The Type Vi Semet Effector-immunity Complex Tae3- Tai3 From Ralstonia Pickettii (NCBI) | Pseudomonas fluorescens | 4HZB_F | 23730712 | ||
SS02140 | Tse1 (Reference); Chain A, Crystal Structure Of Type Effector Tse1 From Pseudomonas Aeruginousa (NCBI) | Pseudomonas fluorescens | 4F0V_A | 25042941;23730712 | ||
SS02141 | Tae4 (Reference); Chain A, Crystal Structure Of The Type Vi Effector Tae4 From Enterobacter Cloacae (NCBI) | Pseudomonas fluorescens | 4HFL_A | 25042941;23730712 | ||
SS02142 | hcp | Hcp (NCBI) | Desulfobacterium autotrophicum | ACN17117.1 | 26093203 | |
SS02433 | HMPREF9534_04876 | Hcp (Reference); Type VI secretion system effector, Hcp1 family (UniProt, NCBI) | Escherichia coli | D7ZKQ6 | ADX52261.1 | 26093203 |
SS02434 | BCAM1857 | TecA (Reference); hypothetical protein BURCENK562V_C3992 (NCBI) | Burkholderia cenocepacia | B4EMB9 | EPZ89291.1 | 27133449 |
SS02435 | PA0262 | VgrG2b (Reference); type VI secretion system tip protein VgrG (NCBI) | Pseudomonas aeruginosa | Q9I6M7 | WP_003147109.1 | 26037124 |
SS02436 | katN | KatN (Reference); Non-heme catalase KatN (UniProt) | Pseudomonas aeruginosa | Q9I1T0 | AGV61017.1 | 28288207 |
SS02437 | EC042_4534 | Tle1 (Reference); T6SS effector phospholipase Tle1-EAEC (NCBI) | Escherichia coli | D3GUW5 | WP_000170556.1 | 26714038 |
SS02438 | rhsB | RhsB (Reference); Protein RhsB (UniProt) | Escherichia coli | P16917 | WP_000015298.1 | 23572593 |
SS02439 | hcpA_1 | Hcp-ET1 (Reference); Hcp1 family type VI secretion system effector (UniProt, NCBI) | Escherichia coli | A0A2Y0FSQ5 | ELG48174.1 | 28060574 |
SS02440 | hcp | Hcp-ET2 (Reference); Hcp1 family type VI secretion system effector (UniProt) | Escherichia coli | A0A3K3ND08 | ELH07638.1 | 28060574 |
SS02441 | A464_149 | Hcp-ET3 (1) (Reference); VgrG protein (UniProt) | Salmonella bongori | S5N4I1 | AGR57335.1 | 28060574 |
SS02442 | Hcp-ET3 (4) (Reference); type VI secretion system effector, Hcp1 family protein (NCBI) | Citrobacter freundii | KEL77525.1 | 28060574 | ||
SS02443 | HMPREF9530_03376 | Hcp-ET3+4 (Reference); Type VI secretion system effector, Hcp1 family (UniProt, NCBI) | Escherichia coli | D8A9Z9 | EFK20023.1 | 28060574 |
SS02444 | hcp | Hcp-ET5 (Reference); Type VI secretion system tube protein Hcp (UniProt) | Salmonella enterica | A0A3J5XDL1 | EHY67871.1 | 28060574 |
SS02445 | hcp | Hcp1 family type VI secretion system effector (UniProt, NCBI) | Escherichia coli | A0A1X0YID2 | ETJ19745.1 | 28060574 |
SS02446 | VPR01S_11_01580 | MIX-effector1 (Reference); hypothetical protein VPR01S_11_01580 (NCBI) | Vibrio proteolyticus | U3BEL6 | GAD68164.1 | 27066305 |
SS02447 | VPR01S_11_01570 | MIX-effector2 (Reference); hypothetical protein VPR01S_11_01570 (NCBI) | Vibrio proteolyticus | U3BNK6 | GAD68163.1 | 27066305 |
SS02448 | BTH_II1883 | TseM (Reference); conserved hypothetical protein (NCBI) | Burkholderia thailandensis | Q2T422 | WP_011401419.1 | 28242693 |
SS02449 | PA2374 | TseF (Reference); hypothetical protein PA2374 (NCBI) | Pseudomonas aeruginosa | Q9I1A5 | NP_251064.1 | 28348410 |