Detailed Information
Basic Information
| BastionHub ID | SS02226 |
| UniProt ID | P05834 |
| NCBI ID | EAA5695944.1 |
| Gene Name | mcbA |
Brief Description
|
McbA (Reference); Bacteriocin microcin B17 (UniProt, NCBI) |
| Secretion System Type | Type I secretion system (T1SS) |
| Species | Escherichia coli |
| Gene Ontology Terms | - |
| Function | This glycine-rich peptide antibiotic inhibits DNA replication in many enteric bacteria, that leads to induction of the SOS repair system, massive DNA degradation and cell death. B17 inhibits type II topoisomerase by trapping an enzyme - DNA cleavable complex. cytolysis, defense response to bacterium and negative regulation of DNA replication. (UniProt) |
| Sequence | MELKASEFGVVLSVDALKLSRQSPLGVGIGGGGGGGGGGSCGGQGGGCGGCSNGCSGGNGGSGGSGSHI |
| Length | 69 amino acids |
| PubMed ID | 8302219 |
Conserved Domain
| Pfam ID | Pfam family | Type | Start | End |
|---|---|---|---|---|
| Sorry. There is no result for this protein entry. | ||||
Protein 3D Structure
| PDB Accession | Method | Resolution | Chain | Structure Review |
|---|---|---|---|---|
| 2IZP | X-ray | 2.10 A | A/B=8-310. | 2IZP |
| 2IXR | X-ray | 2.60 A | A=10-310. | 2IXR |
| 3NFT | X-ray | 1.51 A | A=10-310. | 3NFT |
| 2J9T | X-ray | 2.70 A | A/B=10-310. | 2J9T |
Disorder Area
Post-translational Modification
The processed N-terminus does not resemble a typical secretion signal sequence.Maturation of thiazole and oxazole containing antibiotics involves the enzymatic condensation of a Cys, Ser or Thr with the alpha-carbonyl of the preceding amino acid to form a thioether or ether bond, then dehydration to form a double bond with the alpha-amino nitrogen. Thiazoline or oxazoline rings are dehydrogenated to form thiazole or oxazole rings.
Metabolic Pathway Summary
| Event | Description | PMID |
|---|---|---|
| Sorry. There is no result for this protein entry. | ||
Enzymatic and Metabolic Pathway
| Database | ID |
|---|---|
| Sorry. There is no result for this protein entry. | |
Mutagenesis
| Position(s) | Description | Length | PMID | |
|---|---|---|---|---|
| Sorry. There is no result for this protein entry. | ||||
Pathogen-Host Interaction
| PHI | Gene | Disease | Year | Host species | Experimental | Mutant |
|---|---|---|---|---|---|---|
| Sorry. There is no result for this protein entry. | ||||||
Protein-Protein Interaction
| Database | ID | Interactor |
|---|---|---|
| Sorry. There is no result for this protein entry. | ||
Protein Family
Sorry. There is no result for this protein entry.
Identical Protein
| BastionHub ID | Name | Organism |
|---|---|---|
| Sorry. There is no result for this protein entry. | ||