Detailed Information

Basic Information

BastionHub ID SS02226
UniProt ID P05834 
NCBI ID EAA5695944.1 
Gene Name mcbA
Brief Description McbA (Reference); Bacteriocin microcin B17 (UniProt, NCBI)
Secretion System Type Type I secretion system (T1SS)
Species Escherichia coli
Gene Ontology Terms -
Function This glycine-rich peptide antibiotic inhibits DNA replication in many enteric bacteria, that leads to induction of the SOS repair system, massive DNA degradation and cell death. B17 inhibits type II topoisomerase by trapping an enzyme - DNA cleavable complex. cytolysis, defense response to bacterium and negative regulation of DNA replication. (UniProt)
Sequence MELKASEFGVVLSVDALKLSRQSPLGVGIGGGGGGGGGGSCGGQGGGCGGCSNGCSGGNGGSGGSGSHI
Length 69 amino acids
PubMed ID 8302219

Conserved Domain

Pfam ID Pfam family Type Start End
Sorry. There is no result for this protein entry.

Protein 3D Structure

PDB Accession Method Resolution Chain Structure Review
2IZP X-ray 2.10 A A/B=8-310. 2IZP
2IXR X-ray 2.60 A A=10-310. 2IXR
2J9T X-ray 2.70 A A/B=10-310. 2J9T
3NFT X-ray 1.51 A A=10-310. 3NFT

Disorder Area

Molecule Processing

Feature Key Position(s) Description Length PMID
Propeptide(PRO_0000002772) 1-26 26 8536683
Chain(PRO_0000002773) 27-69 Bacteriocin microcin B17 43 -

Post-translational Modification

The processed N-terminus does not resemble a typical secretion signal sequence.Maturation of thiazole and oxazole containing antibiotics involves the enzymatic condensation of a Cys, Ser or Thr with the alpha-carbonyl of the preceding amino acid to form a thioether or ether bond, then dehydration to form a double bond with the alpha-amino nitrogen. Thiazoline or oxazoline rings are dehydrogenated to form thiazole or oxazole rings.

Metabolic Pathway Summary

Event Description PMID
Sorry. There is no result for this protein entry.

Enzymatic and Metabolic Pathway

Database ID
Sorry. There is no result for this protein entry.

Mutagenesis

Position(s) Description Length PMID
Sorry. There is no result for this protein entry.

Pathogen-Host Interaction

PHI Gene Disease Year Host species Experimental Mutant
Sorry. There is no result for this protein entry.

Protein-Protein Interaction

Database ID Interactor
Sorry. There is no result for this protein entry.

Protein Family

Sorry. There is no result for this protein entry.

Identical Protein

BastionHub ID Name Organism
Sorry. There is no result for this protein entry.

Similar Protein

Multiple Sequence Alignments

Phylogenetic Tree

Homology Network