Detailed Information
Basic Information
| BastionHub ID | SS02266 |
| UniProt ID | Q98I38 |
| NCBI ID | WP_010911029.1 |
| Gene Name | mll2585 |
Brief Description
|
Endo-1,3-1,4-beta-glycanase (UniProt) |
| Secretion System Type | Type I secretion system (T1SS) |
| Species | Mesorhizobium loti |
| Gene Ontology Terms | - |
| Function | hydrolase activity, hydrolyzing O-glycosyl compounds and carbohydrate metabolic process. (UniProt) |
| Sequence | MSFFVNALGVPLPYSGASSHWYSAAGSGPDLYGSSGNDSFYGASGVNVTMHGGTGDDIYYLYAAGNKVAEAAGAGIDTISTWMSYKLPDNVENLVVTNANNYAFGNGLDNIITAKAGHQTLDGGAGNDVLIDGGGGYDTFIVSKGNGSDLIANFAATDTVRLNGYGFTSFDAIHSSMIQAGSNVLLNLGSGEILEFKDTTIDKLQPSQFELPIDKSGMQLSFSDDFNTLNLHNSQGGTWDSNFWWGAPNGSTLSSNNELQWYVDANYAPTSSVHPFSVNNGVLTITAAQAPADIKPLINNYEYTSGILTTHDSFSQTYGYFEIRADLPENAGAWPAFWLLPEDGSWPPELDVVETVGQAANSLIMTAHSNETGTHTKVTSIVSVSNPDGFHTYGLLWTPDKLVWTYDGVQVAETATPSDMNKPMYMLVDLAVGGLAGAPPDHLAAPAEMKIDYVRAYTLDSAPANALNIASSSIGTHSVATHGNSTLHGGSEFGGHA |
| Length | 497 amino acids |
| PubMed ID | - |
Conserved Domain
| Pfam ID | Pfam family | Type | Start | End |
|---|---|---|---|---|
| Q98I38 | Glyco_hydro_16 | Pfam | 262 | 455 |
Protein 3D Structure
| PDB Accession | Method | Resolution | Chain | Structure Review |
|---|---|---|---|---|
| Sorry. There is no result for this protein entry. | ||||
Disorder Area
Molecule Processing
| Feature Key | Position(s) | Description | Length | PMID |
|---|---|---|---|---|
| Sorry. There is no result for this protein entry. | ||||
Post-translational Modification
Sorry. There is no result for this protein entry.
Metabolic Pathway Summary
| Event | Description | PMID |
|---|---|---|
| Sorry. There is no result for this protein entry. | ||
Enzymatic and Metabolic Pathway
| Database | ID |
|---|---|
| BioCyc | MLOT266835:G1G20-2068-MONOMER |
Mutagenesis
| Position(s) | Description | Length | PMID | |
|---|---|---|---|---|
| Sorry. There is no result for this protein entry. | ||||
Pathogen-Host Interaction
| PHI | Gene | Disease | Year | Host species | Experimental | Mutant |
|---|---|---|---|---|---|---|
| Sorry. There is no result for this protein entry. | ||||||
Protein-Protein Interaction
| Database | ID | Interactor |
|---|---|---|
| STRING | 266835.1402 | - |
Protein Family
Sorry. There is no result for this protein entry.
Identical Protein
| BastionHub ID | Name | Organism |
|---|---|---|
| Sorry. There is no result for this protein entry. | ||
Similar Protein
Multiple Sequence Alignments
The multiple alignment file for this entry is too large to visualize. Please direct download the multiple alignment file for this entry or turn to Dowload Page to download multiple alignment files for all entries.